(data stored in ACNUC7421 zone)

EMBL: CP000667.PE516

CP000667.PE516       Location/Qualifiers
FT   CDS_pept        complement(592120..592905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53001"
FT                   /db_xref="GOA:A4X2A1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A1"
FT                   /protein_id="ABP53001.1"
FT                   /translation="MDDDLSSDDRATARTLYIDIETAPSLAHVWGLWRQNIGLSQLLAS
FT                   GRVICLAWKWRGEEGVHFASEHGQGRDAMLASAHRILGEADVVVHYNGKRFDIPTLNRD
FT                   FILAGKLPPAPFRQLDLLETVKRRFRFTSNKLAHISQELGLEGKVKHEGHTLWVRCLAG
FT                   DPEAWEQMAEYNRRDVTLLEQLHDVLMPWLVRAPNPRLTDGVSDVDTCPNCGSTDLARE
FT                   GHAYTATGAYQRHRCRACGAWSRRGRRSHGIDIRPIANN"
     atggacgacg acctgagtag cgacgaccgc gctacggcgc gcaccctcta tattgatatc        60
     gagactgcac cctcccttgc tcatgtgtgg ggtttgtggc gccaaaatat cggactcagt       120
     cagctcttgg cgtccgggcg ggtaatctgc ctggcctgga agtggcgggg tgaggagggg       180
     gtccacttcg cctccgaaca cgggcagggt cgggacgcga tgttggcctc tgcccaccgc       240
     atcctcggcg aggccgacgt ggtggtgcac tacaacggca agcgatttga tatccccaca       300
     ctgaaccggg acttcatact tgctggcaag ctgccaccag caccgttccg gcagctcgac       360
     ctgttggaaa ccgtcaagcg acggtttcga ttcacctcca ataagctcgc gcacatctct       420
     caggagttgg gcctagaggg caaggtcaag cacgagggac acacgctctg ggtcaggtgc       480
     ttggccggcg acccggaggc atgggaacag atggccgagt acaacaggcg ggatgtcacc       540
     ctgctggagc agctacacga tgtgttgatg ccttggctgg tgcgtgcgcc taatccgcgg       600
     ctgaccgatg gcgtcagcga tgtcgacacg tgcccgaact gtgggtctac ggacctggcc       660
     cgggagggcc acgcctacac ggcaaccggg gcatatcagc ggcatcggtg ccgagcctgt       720
     ggcgcctggt cgcgccgggg gcgacgctcc cacgggatcg atatccgacc gatcgctaac       780
     aactga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page