(data stored in ACNUC7421 zone)

EMBL: CP000667.PE518

CP000667.PE518       Location/Qualifiers
FT   CDS_pept        complement(593335..594006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53003"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A3"
FT                   /protein_id="ABP53003.1"
FT                   /translation="MTERDPLRPLSVSQRETLEEATAAYQSQLTADVAGYLTARGIGQD
FT                   LADAHRLGAVVEPMPGHKRFQGMLAIPYLDKDGLPLSMRFRCIEAHEHRDYHHGKYNSM
FT                   TDESTRMFNIGAIHRDGSEIHLAEGEFDTILLDLVFSGAVGVAGARAFLPRHRRMLAGF
FT                   SRIWVWADPDDAGTELANTVTRGLRGARVVRLRGGDVTDIYMAGGAPSLHSLIDAEGGN
FT                   R"
     atgaccgagc gggatccatt gaggcccctg tcggtatcgc agcgtgagac gttggaggag        60
     gctacggccg cctatcagtc ccagctcact gctgatgtgg cgggatacct cacggctcgg       120
     gggataggac aggatctggc agacgcgcac aggctcggcg ccgttgtgga gccgatgccg       180
     gggcataagc gatttcaggg catgctcgcc atcccctatc tggacaagga cggccttccg       240
     ctaagcatgc gatttcgctg catagaggcg cacgagcatc gagattacca tcatggtaag       300
     tacaacagca tgacggatga gtcgactcgc atgttcaata taggtgccat ccatcgcgat       360
     ggtagtgaaa tccatctagc cgaaggggag ttcgatacga ttctgctgga tctggtgttc       420
     tcgggtgccg tgggggttgc gggcgcgcgg gcttttctcc cccggcaccg ccggatgcta       480
     gcgggctttt cgcgaatctg ggtctgggcg gatcctgatg acgccggcac cgagttggcc       540
     aacacggtga cccgtgggct gcgcggcgcg agggtggtcc gtctgcgcgg tggcgacgtg       600
     acagacatct acatggcggg cggggcgcct tccctgcaca gcctaattga cgccgagggg       660
     ggaaaccgat ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page