(data stored in ACNUC7421 zone)

EMBL: CP000667.PE52

CP000667.PE52        Location/Qualifiers
FT   CDS_pept        complement(60722..61651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0052"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52537"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y7"
FT                   /protein_id="ABP52537.1"
FT                   /translation="MANNVSTASVVRKTRSGHERVFSNTPEGSSERAGTRREEGNPVEY
FT                   TSGAASWRKVLRRVVAALIQRPRQRRLGWPVGVPLIAAAAGLLFTTTATTAGGTTLRED
FT                   RRPQLNQLIQDRHTEVAASEQRAAELRATVEARTNALAGSDGTIQQQQERAAASQEPAG
FT                   FTALTGLGVTVELDDAPRRNDGSLPTGVTNHDLVVHQGDVQAVVNALWAGGAEAMSIMD
FT                   VRVLATSAVRCVGNTLLLHGRVYSPPFKIVAIGDPAALQRALAESEGVRLFRDLANTYK
FT                   LGYKETVSTVSVPAFDGSAALRWATVPE"
     atggccaata atgtttcgac agctagcgta gtccggaaga cccgttcagg ccacgaaagg        60
     gtcttctcca ataccccgga ggggtcgtcg gagcgggctg gtacgcgacg agaggaggga       120
     aaccccgtgg aatacacatc cggcgcggcc tcctggcgga aggtactccg gcgggtcgtc       180
     gccgccctca tccaacgccc gcggcagcgc cgactcggct ggccggtcgg cgtaccgttg       240
     atcgccgccg cggccggact tctcttcacc accaccgcta ccaccgccgg gggcaccacc       300
     ctgcgcgagg accggcgccc tcagctcaac cagctcatcc aggaccgcca caccgaggta       360
     gcggccagcg agcagcgggc ggcagagctc cgcgcgacgg ttgaggcccg caccaacgcc       420
     ctcgccggtt ccgacgggac gatccagcag cagcaggagc gggcggcggc cagccaggag       480
     ccggccggat tcaccgccct caccggcctc ggagtgaccg tggagctcga cgacgcgccg       540
     agacgcaacg acggcagcct gcccaccggc gttaccaacc acgacctggt ggtgcaccaa       600
     ggtgacgtac aggccgtggt gaacgccctc tgggccggcg gcgcggaggc gatgtcaatc       660
     atggatgtcc gcgtgctcgc cacaagcgcg gtacgctgcg ttggtaacac cctgctgctc       720
     catggccggg tgtattcccc tccattcaag atcgtagcga tcggcgaccc cgccgccctc       780
     cagcgggcac tcgccgagtc cgagggagtc cggttgttca gggacctggc gaacacctac       840
     aagctgggct ataaggagac ggtctccacc gtgtcagtac cggcgttcga tggctccgcc       900
     gcactccgtt gggcgacggt gcccgaatga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page