(data stored in ACNUC7421 zone)

EMBL: CP000667.PE520

CP000667.PE520       Location/Qualifiers
FT   CDS_pept        complement(595272..596084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A5"
FT                   /protein_id="ABP53005.1"
FT                   /translation="MLNARRALTLNHDAGKELPRIPALDDLYGIGCRFRQGQVIMIAGR
FT                   SGTLKSMFATWLAAKWAVPALYFSADMSAYTASSRVAALVTGDLQEEIEEGMARGGGNR
FT                   QRYLDALASLPLTFAFGTPITWRHIDEEIEAHVELHDSYPSIVVFDNLMDFEAAESDYT
FT                   EQMAVMAGVTAFSRETGCTSIVLHHASDKSWDAKTAPYDPPSRQEVKGGLSEKPELSLT
FT                   VALDPSTMEYKVAVVKQRMGPSDPTARRFARLTAEPERTRFHPYRWRG"
     atgctaaacg cgcgccgcgc actaaccctt aatcacgacg cgggaaagga actacctcgc        60
     attcctgcac tagacgatct ctacggcatc gggtgcaggt ttcgacaggg ccaggtcatc       120
     atgattgcag gtcgcagcgg aacgctcaag tcgatgttcg ccacatggct agcggcgaag       180
     tgggcagttc ccgccctgta tttctctgcg gacatgtctg cctacaccgc tagctctcgg       240
     gtggcggcct tggtgaccgg cgacctccag gaggagatcg aggagggcat ggcccggggt       300
     ggcggcaacc gacagcgcta cctggatgcc ctggcttcgc tgcccttgac gttcgctttc       360
     ggtactccga tcacctggcg ccatatcgat gaggagatcg aggcacacgt cgagctacat       420
     gacagctatc catcaatcgt agtcttcgac aatttgatgg actttgaggc cgccgaatca       480
     gactacaccg agcagatggc cgtcatggcc ggagtgaccg cgttcagccg ggaaaccggc       540
     tgcacgagca ttgtgctaca tcacgcatca gacaaaagct gggacgccaa aacagccccg       600
     tacgatccac cgagtcgcca ggaggtgaag ggcgggttga gcgagaagcc ggagttgtct       660
     ctgacggtgg cgttggaccc atcgacaatg gaatacaagg tggccgtggt caagcagaga       720
     atggggccga gcgaccccac cgcccggcgc ttcgctcgac tcacagccga gcccgagcga       780
     acgcgattcc acccataccg ctggaggggc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page