(data stored in ACNUC7421 zone)

EMBL: CP000667.PE521

CP000667.PE521       Location/Qualifiers
FT   CDS_pept        complement(596148..596612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53006"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A6"
FT                   /protein_id="ABP53006.1"
FT                   /translation="MAFVKPSANVSSEFLKGAEHLNDVAILFEPRSIRKGVPHRHNGVE
FT                   RIRDELKATVTFFRTMADLQDGKPSKVAKDMTITYAMVVGTLEPELPGTPSGGEDGNQV
FT                   AGVLRKIPTSSGSGYVIRDLDDDVWDLVVSYFLRREAAVAEAVAEAPDFD"
     atggcttttg ttaagccctc ggccaacgtg agcagcgagt tcctaaaggg cgccgagcat        60
     ctcaatgatg tggcgatcct gttcgagcca cgatcaattc ggaagggcgt tcctcatagg       120
     cacaacggcg tggaacggat tcgtgacgag ctaaaggcaa cagtcacgtt ctttcgcacc       180
     atggccgacc tccaggacgg aaagccgtcg aaggtcgcca aggacatgac catcacgtac       240
     gccatggtgg tcgggacctt ggagcccgaa ctcccaggca cgccgagcgg cggcgaagac       300
     gggaatcagg tcgccggcgt gttgcggaag attcccacgt caagcgggtc ggggtatgtc       360
     atccgcgacc ttgacgacga cgtttgggac ctggtggtga gttacttttt gcgacgggag       420
     gccgctgtcg ctgaggcggt cgctgaggct cccgatttcg actga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page