(data stored in ACNUC7421 zone)

EMBL: CP000667.PE526

CP000667.PE526       Location/Qualifiers
FT   CDS_pept        complement(599930..600196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53011"
FT                   /db_xref="InterPro:IPR020109"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B1"
FT                   /protein_id="ABP53011.1"
FT                   /translation="MELMTRAFWVYAWERAVKTTAQTALSLMSVDYVGLLEVDWAAVGS
FT                   AAGLAAVLSILTSLTGFSDSAPDAPEPAEAGDPGDTSRELPLT"
     atggagctga tgactagagc gttctgggtg tacgcctggg agcgcgccgt aaaaaccacc        60
     gcacagaccg ccctgtccct gatgtcggtg gactacgtag gacttttgga ggtcgactgg       120
     gccgccgttg gctcggcggc cggtctggcc gcggtgctat cgatcctcac gtcgttgacc       180
     ggattttcgg actccgctcc ggacgctccg gagccggccg aggccggcga tccaggcgac       240
     acttcacgag agcttccgct gacctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page