(data stored in ACNUC7421 zone)

EMBL: CP000667.PE53

CP000667.PE53        Location/Qualifiers
FT   CDS_pept        61674..61979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52538"
FT                   /db_xref="GOA:A4X0Y8"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y8"
FT                   /protein_id="ABP52538.1"
FT                   /translation="MSGRTRSSPPLESVVPKSQVRKKKVYTPPTDVRPTATAATRKPSP
FT                   VWLPATAVTLIVAGIGWLVVYYLSEQEYPVMSWGYWNLAVGFGAMVGSLILLSRWR"
     ttgtcaggcc ggacgaggtc gtcaccccct ctggagagcg tcgtgcccaa gtctcaggtc        60
     cgtaagaaga aggtgtacac cccgccgacg gacgtgcgtc cgacggcgac ggcggcgacg       120
     cgcaagccta gcccggtctg gttgccggcc acggcggtca cactcatcgt cgccggcatc       180
     ggctggttgg tggtctacta cctctccgag caggagtatc cggtcatgtc gtggggttac       240
     tggaacctcg cggtgggctt cggcgcaatg gtcggctccc tgatcctgct ctcacgctgg       300
     cgttga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page