(data stored in ACNUC7421 zone)

EMBL: CP000667.PE537

CP000667.PE537       Location/Qualifiers
FT   CDS_pept        complement(611661..612029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53022"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C2"
FT                   /protein_id="ABP53022.1"
FT                   /translation="MLRPMPSMQRRRGQSATVYPYREVTDRRGHRVRVVDEDNPVVVVA
FT                   AFIPDRSSRAELPGQQQIHVVKMIVRDDVAGCELWAQVEWRGSRWDVVTPPAYHHGTRH
FT                   TRHVTVSLRRRPLTPTEV"
     gtgctgaggc cgatgccctc catgcagcgt aggcgtggtc agtccgccac tgtttatccg        60
     tacagggagg tcacggaccg ccggggccac cgggtgcgcg tggtagatga ggacaacccc       120
     gtcgtggtgg tcgcggcatt catccctgat cgcagttcgc gcgccgagct acccgggcag       180
     caacaaatcc acgtcgtcaa gatgatcgtg cgcgacgacg tggccggttg cgagctgtgg       240
     gctcaggtgg agtggcgcgg ctcacggtgg gatgtcgtca cgcctccggc ctatcaccat       300
     ggcacccggc acacgcgtca cgtgacggtg tcgctacggc gccgcccgct gaccccgacg       360
     gaggtgtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page