(data stored in ACNUC7421 zone)

EMBL: CP000667.PE538

CP000667.PE538       Location/Qualifiers
FT   CDS_pept        complement(612023..612583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53023"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C3"
FT                   /protein_id="ABP53023.1"
FT                   /translation="MSEPFAQVEDVQGRIDFTMSAAEERVAGAALDDMSEEARYHAGQA
FT                   WPVPEEAPRMVRRLVLVAVARYMKNLDGLTQSRAGDETVAFTDLGDKAGAPFFSDAEIE
FT                   TLRRLGGAAQGGFVSAEVTAYRTDLRRYKHHQCTLVNTDGDPFPLNEECWGFGCDCSTW
FT                   HPSGGCRSGYGYGYSTWHPRRGC"
     gtgtctgagc catttgccca ggtcgaggac gttcaaggca ggatcgattt caccatgtcg        60
     gcagccgagg agcgcgtggc cggcgccgca ctggatgaca tgtccgagga ggctcgctac       120
     cacgctggcc aggcgtggcc ggtccccgag gaggcacccc ggatggtgcg ccggcttgtg       180
     ctggtggccg tagcgcggta catgaaaaat ctagatggct tgacccaaag tcgcgctggt       240
     gatgaaacgg tcgcgtttac cgaccttggc gacaaggcgg gagcaccgtt tttttcggac       300
     gctgaaattg aaaccttgcg ccgcctgggc ggcgccgctc agggcgggtt cgtgagcgcc       360
     gaggtaactg cctaccgcac agacctgcga cgctacaagc accatcaatg cacgctggtc       420
     aacacggacg gcgacccgtt cccactcaac gaggagtgct ggggttttgg ctgcgactgc       480
     tctacttggc accctagcgg ggggtgccga agcggctacg ggtacggcta ctccacctgg       540
     catccccgta gggggtgctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page