(data stored in ACNUC7421 zone)

EMBL: CP000667.PE540

CP000667.PE540       Location/Qualifiers
FT   CDS_pept        complement(613745..614242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53025"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C5"
FT                   /protein_id="ABP53025.1"
FT                   /translation="MPEDGPDTNGDTTPEGQALPVTSTDSLPDWAKKELADTRAEAANY
FT                   RTRLREAEASLKEAKTPEEVEAAVKELREGNAKLERDLALANASRGLTDDQAAILAAMT
FT                   WETPGDLTGHVEAIRKLTPPDDRGDTLPLSGTLRGGLTPGDEPGDDFDPAEVARKMRQG
FT                   LL"
     atgccggaag acggtcccga cacgaatggt gacaccactc ccgagggcca ggcgctcccg        60
     gttacctcaa ctgactcgct gcccgactgg gcaaagaaag agctggctga cactcgggcc       120
     gaggcggcga actaccgcac ccggttgcgt gaggccgagg ccagccttaa agaggccaag       180
     actcccgagg aagttgaggc ggctgtcaag gagctgcgtg agggaaacgc caagctggag       240
     cgcgatcttg cgctggctaa cgcgtcgcgc ggcctgaccg acgaccaggc cgcgatcctc       300
     gcggcgatga cctgggagac cccgggcgac ctcaccgggc atgtcgaggc aatccgcaag       360
     ctgaccccgc cggatgaccg gggcgacacc ctccccctct ccggcacgct gcgcggcggt       420
     ttaaccccgg gcgacgagcc cggcgacgac ttcgacccgg ctgaggtcgc ccgcaagatg       480
     cgccagggcc tgctctaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page