(data stored in ACNUC7421 zone)

EMBL: CP000667.PE543

CP000667.PE543       Location/Qualifiers
FT   CDS_pept        complement(616082..617215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53028"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C8"
FT                   /protein_id="ABP53028.1"
FT                   /translation="MTTVHITLSETNPTAEYVALQRYSGAMLFGTRLRVYLDGAAEATV
FT                   DLESTVGRAWRWRAQEIGYHDMVTRTVAVPESETPVEYADLVDVDPETMQPDDEPEAAW
FT                   WQALSETAAGVVPDGSVGLVKLAPDVLAALDEVGQPGPQGDQGLSAYEVAVAGGYSGTE
FT                   ADWLLGLVGPAGLPGATGDPGPGVTAGGTVGQVLAKGSATDHDTEWIDPVPSAHASSHA
FT                   PGGADDLSATYSAVDTVHDSAPPRDYLRRIRLDYPISVGNPDIERIYVGTGAGELSAWR
FT                   NEWGGLRGTPHVAYKADALVRGIPRTDLGASADGGWLELEDASRTTQLYKRDWWGRLWR
FT                   SDGAAAAIQMADVLVLGPGDPVPSGTPAGTVIVRTEA"
     gtgacaacag tccatatcac cctgagcgaa accaacccca cggccgaata cgtcgcactc        60
     cagcgttact caggcgcgat gctgttcggc acacgtctcc gcgtatacct ggacggagcc       120
     gccgaggcga ccgtggatct ggagtcgacg gtcggccggg catggcgctg gcgggcgcag       180
     gagatcgggt accacgacat ggttacccgc accgtcgcgg taccggagtc cgagactccg       240
     gttgaatacg ccgacctggt cgacgtggac cccgagacca tgcagcccga cgacgagcct       300
     gaggcggcct ggtggcaggc gctctcggag accgctgccg gggttgtgcc ggatgggtcg       360
     gtcggcctcg tcaaacttgc gcccgatgtc ctggcggcgt tggacgaggt tgggcagccc       420
     ggcccgcagg gcgaccaggg cttgagtgcc tatgaggtcg cggtggctgg cggctactcg       480
     ggtaccgagg ctgactggct cttggggctg gtggggccag cgggactgcc gggcgctacg       540
     ggcgaccccg gcccgggtgt cacggccggc ggcacggtgg gccaggtgct agccaagggc       600
     agcgcgaccg accatgacac tgagtggatc gatcccgtac cgagcgcaca cgcatcgtca       660
     cacgccccag gtggggcgga tgatctgtcc gccacctatt cggcggtcga cacggtgcac       720
     gactctgccc cgccaaggga ctacctgagg cgcatccgac tcgactatcc gatcagtgtg       780
     ggcaaccccg atattgagcg gatctatgtc gggactggcg ccggcgagtt gtcggcatgg       840
     cgcaacgagt ggggcgggct aaggggcacg ccccatgtgg catacaaggc cgatgcgctg       900
     gtacgcggca tcccgagaac ggatcttggt gcgtccgctg atggcgggtg gctggagttg       960
     gaggacgcta gtcgcaccac tcagctctac aagcgggact ggtggggtcg gctgtggcgg      1020
     tccgatgggg cggctgccgc gattcagatg gccgatgtcc tggtgcttgg tccaggagac      1080
     cctgtgccgt ctggcactcc ggcgggcacc gtcatcgtga ggaccgaggc gtga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page