(data stored in ACNUC7421 zone)

EMBL: CP000667.PE549

CP000667.PE549       Location/Qualifiers
FT   CDS_pept        624413..624658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53034"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D4"
FT                   /protein_id="ABP53034.1"
FT                   /translation="MPREVKHPKFGYTSTVYTLDDLIERLKGLRGEHGGSLAVACEKDS
FT                   SDSVHLLDSLGRYYDAEQAWDDDAHLGAAIVLSIND"
     atgccaagag aggtcaagca cccgaagttc ggctacacca gcaccgtcta cacgctggac        60
     gatctgattg agcggctgaa ggggcttcgc ggtgagcacg gtggcagcct ggccgtggcc       120
     tgtgagaagg actcgtccga ctcggtgcac ctgctcgaca gcctcggcag gtactacgac       180
     gccgaacagg cttgggatga cgacgcgcac ctaggggccg cgatcgtgct ttcgatcaac       240
     gactaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page