(data stored in ACNUC7421 zone)

EMBL: CP000667.PE55

CP000667.PE55        Location/Qualifiers
FT   CDS_pept        64800..65813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0055"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52540"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z0"
FT                   /protein_id="ABP52540.1"
FT                   /translation="MATTSPHRQASARSRRPGGLRRAAHGLLAAVAAVAVGLGVLAVPA
FT                   YAEPSVDEIEAAIDKQWREMEPTIAQYNKVRAQLKENRKKSDELAKKIAPLQLESEIAT
FT                   KRIGGLASEYYISGPSRELGALLVSDDPNEISEELALLNRVAAMERKQLEEVLAIRKEY
FT                   DDQKETLDELIAAQDKQESELAARKKQIDAEIKRLKASLPKTTVSTPQCPTVNGVVSAA
FT                   ARTAIRTACAQVGDPYVFGSSGPNSFDCSGLTQYAYKAAGVYLTHYTGAQWNEGKAISR
FT                   SEARPGDLVFFSSPSNLHHVGLYLGNDQMVHAPRTGKPVMVGSINYMPVAGFRRPG"
     gtggcaacca cgtcccctca tcgtcaggcc tcggcgcggt cgcgccgtcc gggagggctg        60
     cgtcgggccg cccatggtct gctcgccgcg gtcgccgcgg tcgcggttgg tctcggtgtg       120
     ctggcagtcc ccgcgtacgc cgagccgtcg gtggacgaga tcgaggccgc gatcgacaaa       180
     cagtggcgcg agatggagcc cacgatcgcg cagtacaaca aggttcgggc gcagctgaag       240
     gaaaaccgta agaagtcgga cgaactggca aagaagatcg ctccgctcca gctggagagc       300
     gagatcgcga cgaagcggat cggtggcctg gcctcggagt actacatcag tgggccgtca       360
     cgggaactcg gcgcgctgct ggtgagcgat gacccgaatg agatcagcga ggagctggcc       420
     ttgctgaacc gggtcgccgc catggagcgc aagcagctcg aggaagtgct ggcgatccgc       480
     aaggaatacg acgaccagaa agaaacgctc gatgagttga ttgccgcgca ggacaagcag       540
     gagagcgagc tggcggcgcg aaagaagcag atcgacgccg agatcaagcg tctcaaggct       600
     tcgctgccga agaccacggt gtcgaccccg cagtgcccca ccgtcaatgg tgtggtcagc       660
     gcggctgccc gaaccgccat ccgaaccgcc tgcgcgcagg tgggcgaccc gtacgtcttt       720
     ggtagctccg gccccaactc gttcgactgc tccgggctga cgcagtacgc gtacaaggcg       780
     gccggcgtct acctgacgca ctacaccggc gctcagtgga acgagggcaa ggcgatctcg       840
     cggtccgagg cgcgccccgg tgacctcgtc ttcttctcca gccccagcaa cctgcaccat       900
     gtcggcctgt acctcggcaa tgaccagatg gtgcacgcgc cccggaccgg taagccggtc       960
     atggtgggca gtatcaacta catgccggtc gccggattcc gtcgaccggg ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page