(data stored in ACNUC7421 zone)

EMBL: CP000667.PE550

CP000667.PE550       Location/Qualifiers
FT   CDS_pept        624738..625118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53035"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D5"
FT                   /protein_id="ABP53035.1"
FT                   /translation="MIEIEQARELLAKAVETQGWDFVYNPGGNGPCKYEPISVHEAGGN
FT                   PDDPRTKTGCLIGVVLGMVDENRHRGLSNTIDALGEGALRGLMSHETTRYFRVAQHAQD
FT                   AGRTWGAAYDAAEAHYRAHYAR"
     gtgattgaaa tcgaacaggc gcgtgaactg ctggccaagg cagtagaaac gcagggctgg        60
     gatttcgtgt acaacccggg cggaaatggc ccctgcaagt acgaaccgat ttctgtacac       120
     gaggctggag gcaacccaga cgacccccgc acaaagaccg ggtgcctgat cggggtggtg       180
     ctgggaatgg ttgatgagaa tcgtcaccga ggactctcga acaccattga cgccctcggg       240
     gaaggcgcac tgcgcgggct gatgtcccac gaaacaactc ggtatttccg cgttgctcag       300
     cacgcgcaag atgccggacg cacctggggc gcggcgtacg acgcggccga ggctcactac       360
     cgagcccact acgcccgctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page