(data stored in ACNUC7421 zone)

EMBL: CP000667.PE552

CP000667.PE552       Location/Qualifiers
FT   CDS_pept        625861..626532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53037"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D7"
FT                   /protein_id="ABP53037.1"
FT                   /translation="MPRRIRMANPMQARSQGQTLNELVNSTMAELGGVFECMGWAEDEI
FT                   ASAIRRHPGQRDALFHAFSLIKPRDELGIGMGTEFVVRSHMAELLERVAVGGDTRPATA
FT                   AEMCLMVGEVSQRVPLNSAAAGLYFRLWFSAFPSHPLATEHLPDQVHYERLHQTQIDDL
FT                   ESDLAARGGDQYRQLKSVDCRGWHHGERVNCRYASRAHGGHEARGSGRPGRKRIASMRN
FT                   R"
     ttgccaagga ggatccggat ggcgaacccg atgcaggctc gcagtcaggg acaaaccctg        60
     aacgagttgg tcaatagcac catggcagag ctaggagggg tattcgagtg catggggtgg       120
     gctgaggacg aaatcgcgag cgcgattcga cgtcatcctg gccaacgcga tgcgctattc       180
     cacgctttct cgctcatcaa gcctcgcgac gaactcggga tcggtatggg taccgaattt       240
     gtggtccgct cccatatggc cgagttgctg gagcgcgtcg ccgtgggcgg tgacacccgg       300
     ccggctacgg cggccgagat gtgcctgatg gttggtgagg tgtctcaacg cgtgccgttg       360
     aacagcgctg ctgctgggct gtactttcgc ctgtggttca gcgcatttcc gagccacccg       420
     ctcgcgacag agcacttgcc ggaccaagtg cactatgaac gactgcacca aacccagatc       480
     gacgatctcg aaagcgatct agcggctcgc ggtggcgacc agtatcgcca gttgaagagc       540
     gtcgattgtc gtggatggca ccacggtgag cgcgtcaatt gccggtatgc gagccgcgcg       600
     catggagggc acgaagcccg ggggtcgggc cgccctggcc ggaagcgcat cgcttcgatg       660
     cgaaaccgct ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page