(data stored in ACNUC7421 zone)

EMBL: CP000667.PE556

CP000667.PE556       Location/Qualifiers
FT   CDS_pept        629708..631102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0559"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53041"
FT                   /db_xref="GOA:A4X2E1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E1"
FT                   /protein_id="ABP53041.1"
FT                   /translation="MKSRSVRIWEIRINKGAGKKKTYTVRWIVGGRVSSRNFASRALAD
FT                   NYRSDLMQAANRGEAFDAATGLPDSMTEPKNAMSWLEFVASYVDVKWPGAAAKSRESMI
FT                   DALATVTPALVRDQPGRPGPVELRRVLRDHLLPPAVRESEVPADLAPALRWLRRASLPL
FT                   AEVGETVAVRGALEALAVRLDGRAAAATTVRRKRSVFYNALQYAVELDALPFNPVDKIR
FT                   VRGQRAKIAKSIDRRVVINGRQARELLTAVSYVGERGRDGRRGERLVAFFGCLYFAALR
FT                   PSEALALREQDCDLPETGWGRLTLEKSRPAAGKRYTDSGEVHDRRGLKHRAVAEARTVP
FT                   IPPVLVKALRVHLDRFGAAKDGRLFRSERGNVVSSTTYSRVWKAARELALTPAQVASPM
FT                   AGRPYDLRHAAVSLWLNKGVPAPDVADRAGHSVDVLLKVYAKCIDGQEATVNQRIEEAL
FT                   DDDSHG"
     gtgaagtcgc ggtcggtgcg gatctgggag atccgcatta ataagggtgc cggcaaaaag        60
     aagacctata ccgtgcggtg gatcgttggc gggcgggtga gttcacgcaa ctttgccagc       120
     cgcgcactgg cggacaacta tcgatccgat ctcatgcaag cggccaaccg cggtgaggcg       180
     ttcgatgccg ccaccggcct gccggactcg atgaccgagc cgaagaacgc gatgtcgtgg       240
     ctggagttcg tagcgtcgta cgtggatgtg aagtggcccg gcgcggcggc caagtcccgg       300
     gagagcatga tcgacgcact ggcgacggtg accccggcat tggtccgtga ccagccgggt       360
     cggccggggc cggtcgagct tcgccgcgta cttcgtgatc acctgctgcc gccggcggtc       420
     cgtgagtcgg aggtgccggc cgacctggca ccggcgctgc gctggcttcg gcgggcctcg       480
     ctgccgctgg ctgaggttgg ggagacggtc gccgtgcggg gcgcgcttga agccttggcg       540
     gtccggcttg acgggcgggc cgcggcagcg acgacggtac ggcgcaagcg atcggtcttc       600
     tacaacgcgc ttcagtacgc ggtggagctg gacgccttgc cgttcaaccc ggtcgacaag       660
     atccgggtgc gggggcagcg ggcgaagatc gccaaatcga tcgaccggcg ggtggtgatc       720
     aatggccggc aggcccggga gctgctgact gccgtgtcgt acgtgggtga acggggacgc       780
     gacggccggc gtggtgagcg cctggtcgca ttcttcggct gcttgtactt cgctgcactg       840
     cgtccgagcg aggcgctggc cctgcgggag caggactgtg atcttcccga gacggggtgg       900
     ggccggctga cgttggagaa gtctcggcca gcggccggga agcggtacac cgacagtggt       960
     gaggtgcacg accggcgcgg cctaaagcac cgggcggtag ccgaggcgcg taccgtgccg      1020
     atcccgccag tcctggttaa agccctgcgg gtacatctgg accggttcgg ggcggcgaag      1080
     gatggtcggc tgttccgcag cgaaaggggc aacgtggtgt cctctacgac ctactcccgg      1140
     gtctggaagg cggcccggga gttggcgctg actccggctc aggtggcatc tccgatggcg      1200
     ggtcggccgt acgacctgag gcatgcggcg gtgtcgctct ggctgaacaa gggcgtcccg      1260
     gcgcccgatg tcgcggaccg cgctgggcat tcagtcgacg tgctgctcaa ggtgtacgcc      1320
     aagtgcatcg atggccagga ggccaccgtc aaccagcgca tcgaggaggc gttggacgac      1380
     gactcgcatg ggtag                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page