(data stored in ACNUC7421 zone)

EMBL: CP000667.PE561

CP000667.PE561       Location/Qualifiers
FT   CDS_pept        complement(634929..635897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53046"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E6"
FT                   /protein_id="ABP53046.1"
FT                   /translation="MAEGSPKAWLMLAVGTDRQHGGNDGYDDDPDAHYSWDHTVANARA
FT                   VAVGDRIVLWDKKAVIGASVIQGIETGWAEKILYRCRHCGGANIKRRRQEAPRFRCTPC
FT                   DRTFEEALTRVERVETFRSRHDANWLDLGRCLDGDTLRALCVSPRSQHSMRPLRWDAFG
FT                   KALDQAGRARDTARLSEATAWAQSLPGGHRQARVRVRVGQSGFRRRLLAALGPVCAFTG
FT                   SSPAAALEAAHLYSYATLGQHHDDGGLLLRRDLHRLFDRGDIAVDPATLTISLRSDLLT
FT                   YPSYAPLQGKPLATKLESGHRSWIQKHWEQHRLTPLTAGIP"
     atggccgaag gttcgccgaa ggcttggctg atgttggccg tcggtacgga tcgccagcac        60
     ggcggcaacg acgggtacga cgacgacccc gacgctcact acagctggga ccacaccgtc       120
     gccaacgccc gcgccgtggc tgttggcgac cggatcgtcc tgtgggacaa gaaggcagtc       180
     atcggcgcct ccgtgatcca gggaatcgag acaggttggg ccgagaaaat cctctaccgg       240
     tgccgccact gtgggggcgc gaacatcaag cgacgcaggc aagaggcacc taggttcagg       300
     tgcaccccct gcgacaggac gttcgaggaa gccctgaccc gtgtggagcg ggtggagacc       360
     ttcaggtcgc gccacgacgc caactggcta gatcttggcc gttgcctgga cggagacacc       420
     ctacgtgcgc tgtgcgtgtc cccaagatcc cagcacagca tgaggccact gcgctgggac       480
     gcattcggta aggcgctgga tcaggctggt agggcgcgtg acacagcgag actcagcgag       540
     gcgacggcat gggcgcagtc ccttccagga ggtcaccgcc aggccagggt acgagttcgt       600
     gtcggccaga gcgggttcag gagacgcttg cttgcggcgc tgggcccggt ctgtgccttc       660
     accggatcca gccccgcggc ggcgctggaa gcagcccatt tgtacagcta cgccacactc       720
     ggtcaacatc acgacgatgg cgggctgctg ttgagacggg atcttcatcg gctcttcgac       780
     agaggcgaca tcgctgtcga ccctgccacc ctgaccatca gcctgcgcag cgacctgctc       840
     acgtacccga gttacgcgcc tcttcagggc aagccgcttg caacgaagtt ggaatccggc       900
     cacagatcct ggatacagaa gcactgggag caacaccgac tcacccctct taccgccggc       960
     ataccatga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page