(data stored in ACNUC7421 zone)

EMBL: CP000667.PE563

CP000667.PE563       Location/Qualifiers
FT   CDS_pept        637247..638563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53048"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E8"
FT                   /protein_id="ABP53048.1"
FT                   /translation="MSARNLYSVAPSAARLTDSLRDIGYDFPTAVADVVDNSVAAGANR
FT                   VEIDIVFDGFDSWVMIADDGEGMSANGLLEALRYGSRRDYGRGDLGRYGLGLKTASLSQ
FT                   CRSLTVVSRRRAATARTVSRMIDLDLIAEVDDWVVAEPANDERVVKARETVADTGGTVV
FT                   LWRGLDRVLPERKPEGGWARRRLEALAGRTADHLGTVFHRFLEGEVGDGLVITVNGEKV
FT                   QPWNPFAPDEPSREVLPPLRFEVTVGEATGTVSLQRYVLPSRDQFSSQAEFERLSGPLN
FT                   WNRQQGLYVYRAQRLVQWGGWNGMRGIDEHTKLARAALDFDTDLDVVFNINVAKIRVAM
FT                   PPQLRQLLERPVHELCMRADDAYRKNSRGASEGAEVASEQLAALSRSEASGATPPMPVV
FT                   GLALRAAAMRAGEYAALQRIGERLRAEAPDVAAALGFRD"
     gtgagcgctc ggaacctgta cagcgtggcg ccgtctgctg cgcggttgac cgactcgctg        60
     cgcgacatcg gttacgactt tccgacagcg gtggccgacg tggtggacaa cagtgtcgcc       120
     gcaggcgcga atcgcgtcga gatcgacatc gtgttcgacg gcttcgactc gtgggtgatg       180
     atcgccgatg acggcgaggg tatgagcgcc aacggcttgt tggaggcgtt gcgctacggc       240
     agccggcgcg actacggtcg cggcgacctc ggccggtacg ggctgggatt gaagaccgca       300
     tctctgtcgc agtgtcggtc cctgacggtg gttagtcgca ggagggccgc cacggcgcgc       360
     accgtgtcac ggatgatcga tctcgatctc atcgccgagg tggatgactg ggttgttgca       420
     gaaccggcga acgacgagcg ggttgtcaag gcccgcgaga cggtggcgga cacggggggc       480
     accgtggtgc tctggcgcgg acttgaccgc gttctgcccg agcgtaagcc agagggcggc       540
     tgggcacgtc gccggttgga agcgctggcg ggcaggacgg ctgaccacct gggtacggtc       600
     ttccaccgct ttcttgaggg cgaggtcggt gatggcctcg tgatcacggt gaacggcgag       660
     aaggtccagc cgtggaaccc gttcgccccg gacgagccat cgcgagaggt gcttcctccg       720
     ctccgttttg aggttaccgt cggtgaggcc accggcacgg tctcattgca gcggtacgtc       780
     ctgccgtccc gcgaccagtt ctcgtcccag gcggagttcg agcggctctc gggcccgctg       840
     aactggaacc gtcagcaggg cctgtacgtc taccgtgccc agcggttggt ccagtggggc       900
     ggatggaacg gcatgcgggg catcgacgag cacacgaagc tcgcgcgggc ggcactggat       960
     ttcgacacgg atcttgacgt ggtgttcaat atcaacgtgg cgaagatcag ggtggcgatg      1020
     ccgccgcagc tgcgccagct gctcgaacgt ccggtgcacg agctgtgcat gcgggcggac      1080
     gacgcctacc gcaagaactc gcgtggagcc tccgagggcg cggaggtagc ctccgagcaa      1140
     ttggcagccc tgtctcgcag cgaggcatct ggggcgacgc cacccatgcc ggttgtcggc      1200
     ttggcgctcc gagccgctgc gatgcgtgcg ggtgagtacg ccgctctgca acgcattggg      1260
     gagaggctgc gggccgaagc ccctgatgtc gccgctgcgc tcggcttcag ggactga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page