(data stored in ACNUC7421 zone)

EMBL: CP000667.PE568

CP000667.PE568       Location/Qualifiers
FT   CDS_pept        644580..646094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53053"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F3"
FT                   /protein_id="ABP53053.1"
FT                   /translation="MSVWFQEVPTEGSVELPPDPRALDALGRNHSLETALADLVDNSLD
FT                   AGATEILIRFVQWGTRLVGLYVVDNGRGIAPESIDDAMTVGGQRQYTGNDLGHFGLGLK
FT                   AASFSQAASLTVLSRAAGRKPVGRRWQLDLVRHSFDCDIVPDSFVAAELNRDWQLPNGS
FT                   SGTVVRWDSVSGFPSSDDPEQVDEFLSRTVSHLQGHLGLTFHRILSDRGVRIVIDVEDA
FT                   DLGPGVRHPVTPIDPFAYPDTLAGWPKQLRAPIDGAKVVLDCHIWPRRSNAPEYRLPGG
FT                   AETRQGLYFYRRGRLLHAGGWEGIHAPDTRLQLARVRIDIDGDTAGLFVMNPEKSRVSA
FT                   GPRFAPAVAAAHADDGTTITDYLQAAEAAWAAANRRRTARRSAALPPGKGFHPKVAREI
FT                   RDELPLLHEDPVNIQWKRFTTDAFLEFDRDTRTLWLNRAYRQALLGGRRGGGNDLPVLK
FT                   ALLFLLAGNVFEGAHFGARDKDNIELWQEVLTVAAKAERSTFEARQ"
     atgtccgtct ggttccagga ggttcccacc gagggatcgg tggagctccc acccgatccg        60
     cgagccttgg acgccctcgg ccgcaaccac tcgctggaaa ccgctctggc cgacttggtc       120
     gacaactccc tcgacgccgg cgcaaccgaa atcctcatcc ggttcgtcca atggggcacc       180
     cggctggtcg gcctctacgt cgtcgacaac ggtcgcggca tagcacccga gagcatcgat       240
     gacgcgatga ccgtcggcgg gcaacgccag tacacgggga atgacctcgg ccacttcggc       300
     ctcgggttga aagcggcatc tttcagtcag gcagccagcc tcaccgtgct ctcgcgcgca       360
     gccggacgta agccggtcgg acgacgctgg cagctcgacc tcgtgcggca tagcttcgac       420
     tgcgacatcg ttcctgattc gttcgtcgcc gccgaactca accgcgactg gcaactcccg       480
     aacggctcct cgggtacagt cgtgcggtgg gacagcgtca gcggttttcc ctcctcggac       540
     gaccccgagc aggtcgacga gtttctgagt cgcacggtct cgcatctgca gggacacctc       600
     ggcctgacct tccaccgcat actctccgac cgcggtgtgc ggatcgttat cgatgtggag       660
     gacgcggacc tcggccccgg cgtccgccat ccggtaacgc cgatcgatcc ctttgcctac       720
     cccgacaccc tggctggctg gccgaaacag ctgagggcgc cgatcgacgg ggcaaaagtg       780
     gttctcgact gccacatctg gccgcgccgc tccaacgcac ctgaataccg gcttcccggt       840
     ggggccgaga cgcggcaggg cctgtacttc taccgccgtg gccgactcct gcacgccgga       900
     ggctgggagg gcatccacgc gcccgacacc cgactccagc ttgcccgagt ccgcatcgac       960
     atcgacggcg acaccgcggg actgttcgtc atgaaccccg agaagtcccg ggtgtcggcc      1020
     ggaccccgct tcgcccctgc cgtcgccgcg gcacacgccg acgatggcac cacgatcacc      1080
     gactacctcc aagccgcaga agcggcgtgg gccgccgcca accgccgcag gaccgcacgg      1140
     cgcagtgccg ctttaccacc cggcaagggt ttccatccca aagttgctcg cgagatccgc      1200
     gacgagctgc ccctgctcca cgaggacccc gtcaacatcc agtggaagcg gttcacgacg      1260
     gatgcattcc tcgagttcga ccgcgacacc agaacgctgt ggctcaatcg ggcgtaccgg      1320
     caggccctgc tcggtggccg acgcggcggc ggcaatgatc tgccggtgct gaaggctctg      1380
     ctgttcctcc tcgccggcaa cgtcttcgag ggcgcccact tcggtgcccg cgacaaggac      1440
     aacatcgagc tctggcagga agtcctgacc gttgccgcga aggcggagag atcgaccttc      1500
     gaggcccgcc agtga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page