(data stored in ACNUC7421 zone)

EMBL: CP000667.PE569

CP000667.PE569       Location/Qualifiers
FT   CDS_pept        646091..647080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53054"
FT                   /db_xref="InterPro:IPR025534"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F4"
FT                   /protein_id="ABP53054.1"
FT                   /translation="MTTAADRHLSTDSFSTYLHTRAPIDHPIPGSPRVVLFVDPHTSRV
FT                   GLRGPATPHEIPPAGLEHLTAQAVHHGGQRMIEIAVTDPRLFVDAYPLLCAVADRVQLD
FT                   QQTLTAALAETLRRLGHLLQTEDVLPQENETGLVGELLVLAGLVYAVGPDTALTAWRGG
FT                   RAEEHDFGLDEHDVEVKTTMSERRSHWVSSLTQMVATGDRPLWLVSLQITTAGSGGRSL
FT                   PELITAVRALLPTTMQHHEFDGLLCASGWRDRYTATCQRRWRLRTPPRVFAVTEAFPRL
FT                   TPRLLAHAGVEVTHVTDVRYRLDLTDLTGDETPQILNDALTRGQRELP"
     gtgaccaccg cagcagaccg tcacctcagc accgacagct tcagcaccta cctccacacc        60
     cgggccccga tcgaccaccc cattcctgga tcaccgcggg tggtgctctt cgtcgaccct       120
     cacacctccc gtgtcgggct tcgcggaccg gcaacgcccc acgagattcc accagccgga       180
     ctcgaacacc tcaccgccca ggccgtccac cacggtggac aacgcatgat cgagattgcc       240
     gtcaccgacc cacggctgtt cgtggacgcc tacccgctgc tgtgcgccgt cgccgaccgg       300
     gtccagctgg accagcagac actgaccgcc gcgctcgctg agaccctgcg ccgcctgggc       360
     cacctcctac aaacagagga tgtcctcccg caggagaatg agaccgggct cgttggggaa       420
     ctgctcgtcc tcgcaggcct cgtgtacgcc gtcggacctg acaccgcgct gacagcatgg       480
     cgcggcgggc gagccgagga acacgacttc gggctggacg agcacgacgt cgaggtcaag       540
     accacgatgt ccgaacgacg ctcacactgg gtctcctcgc tgacccagat ggtcgcgaca       600
     ggggaccggc cgctctggct ggtgtccctg cagatcacca cagcgggcag cggcggacgc       660
     tcccttccgg aactcatcac ggcagtccgc gccctcctgc ccaccacgat gcagcatcac       720
     gagttcgacg gcctgttgtg cgcctcgggc tggcgtgacc gatacacggc cacttgccag       780
     cgtcgatggc gactacgaac ccctccccgg gtattcgcgg tcaccgaggc gtttccccgc       840
     ctgacgccga ggctgcttgc gcacgccggt gtcgaggtca cccacgtgac cgatgtccgt       900
     taccggctgg atctgaccga cctcaccggc gacgagacgc cacagatcct gaatgacgca       960
     ctcacgaggg gacaacggga attgccatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page