(data stored in ACNUC7421 zone)

EMBL: CP000667.PE570

CP000667.PE570       Location/Qualifiers
FT   CDS_pept        647077..649980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53055"
FT                   /db_xref="InterPro:IPR018310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F5"
FT                   /protein_id="ABP53055.1"
FT                   /translation="MSDTVTTAYSAALDAMQRTGPKRLHALAAMLGADTPDIADGSALL
FT                   AHLRDAGPEDALRQQIAHTLAGWDHEQSSAPWTEGTINNTAERRAAVIAALAVEDPTAD
FT                   LIADLFPYAVADGVIVIADDWEEWRTPQRRAERTFYWAHYHRYLLDKWRNPDAVADLDR
FT                   ATEEVVRRLSDPTRPVAYQAKGLVVGYVQSGKTANFTGVVAKAVDAGYRLVIVLTGTTN
FT                   MLRAQTQRRLDIELCGRENIEREISPHDQKAHEYQNDPDWKGDRFVRHGGRPSDAGYPD
FT                   IHRLSNHAGDYRRLKMGFSVLEFRGRERNRKFFDPANLHTSDARLVVAKKNASVLEALV
FT                   ADLGRISDRLGEVPVLIVDDESDQASVNTVSPKKWKEDSKKRTAINRLIGQLLRMMPRA
FT                   QYVGYTATPYANVFIDPSDVEDIFPRDFLISLPRPDGYMGAEDFHDFDVELPLDQRPLT
FT                   TSKERAHVRYLGDEPDDSELRCAVDMFVLTGALKLYRQRHGTSYRHHTMLVHEAMGKDS
FT                   HRQTAELIGHLWNAAGYYQPTGLARLRDLYHTDVLPVSRAQAPTLLTPNNFDDLRDDIG
FT                   DALRLISPADRNGSPVIVVNSDTDLEKQQESLDFDQREIWRILVGGNKLARGFTVEGLT
FT                   VTYYRRTTAQVDTLMQMGRWFGFRPGYRDLVRLYTTPDLHDMFEAACRDEDFLRRELRQ
FT                   YAAPTGGSPQLTPRQIPPLIAQHRPDLRPTGRNKMWNAMLVLKSSPGRPMEPVAFPSTV
FT                   AKVKHNLEQWKPLIAAATERTVRFAVPGAKTTYTAGVAAISHPTLLTVLCNLKWLADDT
FT                   FQPELAWLRRLSTDQLARWVVFLPQQTRSTTRRVVAGHGPISVFERQRTSSGASFRVFS
FT                   EERHRNAAMRIAGIETPIPDSEADALRGRATGAIILYPTVEKDNLEPGEDGAVADEKVT
FT                   VGFHLVTPLSAVPAGGKLMHWATLDKMNPRALVVDAL"
     atgagtgaca ccgtcaccac cgcgtacagc gccgcgcttg acgcgatgca gcgcaccggc        60
     cccaagcgtc tgcacgcgct ggccgccatg ctgggcgccg acacccccga cattgccgac       120
     ggctccgcgc tgctggccca cctacgcgac gctgggcccg aggacgccct gcgccagcag       180
     atcgcgcaca cgctggccgg gtgggatcac gagcagagca gtgccccatg gaccgaaggc       240
     accatcaaca acaccgccga acgccgcgcg gcggtgatcg ccgcgctcgc cgtcgaggac       300
     cctacagcgg acctgatcgc cgacctgttc ccctacgccg tcgcagacgg ggtcatcgtc       360
     atcgccgacg actgggagga gtggcgcacc ccgcaacgcc gtgccgagcg caccttctac       420
     tgggcgcact accatcgcta cctgctcgac aagtggcgca accccgacgc cgtcgccgac       480
     ctcgacaggg ccaccgaaga ggtcgtccgg cgtctgtccg accctacccg acccgtcgcc       540
     tatcaggcca agggccttgt cgtcggatac gtccagagcg gcaagaccgc caacttcacc       600
     ggcgtcgtgg ccaaagccgt cgatgccgga taccgactcg tcatcgtcct gaccggcacc       660
     accaacatgc tgcgcgccca gacccagcga cgcctcgaca tcgaactgtg tggtcgggag       720
     aacatcgaac gggagatctc cccccacgac caaaaggccc acgagtacca gaacgacccc       780
     gactggaagg gcgaccggtt cgtccgtcac ggaggacggc cctccgacgc cggatacccc       840
     gacatccacc ggctgagcaa ccacgctggc gactacaggc ggctcaagat gggcttctcc       900
     gtcctcgagt tcaggggacg tgagcgaaac cgcaaattct tcgacccggc gaacctacac       960
     accagcgacg cccgtctcgt cgtcgccaaa aagaacgcct ctgtcctcga ggcgctggtg      1020
     gcggacctgg gtcgcatcag cgaccgcctc ggcgaggtcc ccgttctcat cgtcgacgac      1080
     gagtccgacc aagcctcggt caacacagtc agcccgaaga agtggaagga ggacagcaag      1140
     aagcgcaccg cgatcaaccg gctcatcggg cagctgctgc ggatgatgcc ccgcgcgcaa      1200
     tacgtcggct acaccgccac cccgtacgcc aacgtcttca tcgacccctc ggacgtcgag      1260
     gacatcttcc cgcgcgactt cctcatctcg ctgccccgac ccgacggcta catgggggcg      1320
     gaggacttcc acgacttcga cgtcgaactg cccctcgacc aacgaccgct caccacgtcg      1380
     aaagaacggg cccacgttcg ctacctcggc gacgaacccg acgacagcga actacgctgt      1440
     gccgtcgaca tgttcgtcct caccggcgcc ctcaagctgt accgacaacg acacggcacc      1500
     tcctaccggc accacaccat gctcgttcac gaggcgatgg gcaaggactc ccaccgacag      1560
     accgccgagc tgatcggcca cctgtggaac gccgccggct actaccagcc caccggacta      1620
     gcccggctcc gcgaccttta ccacaccgac gttctccccg tctcccgcgc acaggcaccc      1680
     acactgctca caccgaacaa cttcgacgac ctgcgcgacg acatcggcga cgcactgcgg      1740
     ctgatcagcc ccgccgaccg taacggcagc ccggtcatcg tcgtgaacag cgacaccgac      1800
     ctcgaaaagc agcaggagag cctcgacttc gaccagcgcg agatctggcg gatcctcgtc      1860
     ggcggtaaca agctcgcccg cggcttcacc gtcgaagggc tgaccgtcac ctactaccgg      1920
     cgcaccacag ctcaggttga cactctcatg cagatgggcc gctggttcgg cttccgaccc      1980
     ggctaccgag acctggtccg cctctatacc acccccgacc tgcacgacat gttcgaggcc      2040
     gcctgccgcg acgaggactt cctccgacga gaactgcgcc agtacgctgc gccgaccggc      2100
     ggctctccgc agctgacccc ccggcagatc ccacccctga tcgcccagca ccgtccggac      2160
     ctacgaccga ccgggcgaaa caagatgtgg aacgccatgc tcgtcctgaa gagctcgccc      2220
     ggcaggccaa tggaacctgt ggcattccct tcgaccgtgg cgaaagtgaa acacaacctc      2280
     gaacagtgga agccgctgat agctgccgca actgagcgaa cggtcaggtt cgcagtgcca      2340
     ggggccaaga ccacctacac ggcgggagtg gcagccatca gccacccgac gctcctcacc      2400
     gtactttgca acctcaagtg gctggctgac gacaccttcc agcccgaact cgcgtggcta      2460
     cgccggctga gcaccgacca actcgcacgg tgggttgttt tcctacccca gcaaaccagg      2520
     tctaccaccc ggcgcgttgt tgccggtcac ggaccgatca gcgtattcga acgccaacgc      2580
     acatcgtctg gtgcatcgtt ccgtgtgttt agcgaggaaa gacaccgcaa tgcggccatg      2640
     aggatcgctg gcatcgagac gccgatcccg gactccgagg ccgacgcact caggggcagg      2700
     gccaccggtg cgatcatcct ctacccgacc gtcgaaaagg acaaccttga gcccggggag      2760
     gatggagctg tcgctgatga gaaggtcact gttggcttcc atcttgtcac tcccctcagc      2820
     gcggtgcccg ctggcggaaa gctgatgcac tgggcgacct tggacaagat gaatccgaga      2880
     gcgctagtag tcgatgcact atga                                             2904
//

If you have problems or comments...

PBIL Back to PBIL home page