(data stored in ACNUC7421 zone)

EMBL: CP000667.PE575

CP000667.PE575       Location/Qualifiers
FT   CDS_pept        complement(653600..654076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53060"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G0"
FT                   /protein_id="ABP53060.1"
FT                   /translation="MAVEYRLTLAGDIPLEQVAELAAPEAVETSTASGGRMLSADLNDE
FT                   RGYVVDITGGRHGYYSAEDDGGALWEWEPKTYVDVSFYMRKDTLADRGKTHMLAAVART
FT                   LAGRAEDAALTLNGDVLMLTRVAGTLRKHNTHGWCCRDVPSIVGGHMTSAEVYP"
     gtggctgtcg agtaccggct gacgctggca ggcgacatcc cgctcgaaca ggtggcggaa        60
     ctggccgctc cggaagcggt cgagacgtcc acggcgtctg gcggcagaat gctcagcgcc       120
     gacctgaacg acgagcgcgg gtacgtcgtg gacatcaccg gcggccggca cggctactac       180
     agtgccgagg acgacggtgg cgctttgtgg gaatgggagc cgaagaccta cgtcgacgtc       240
     agcttctaca tgcgcaagga caccctggcc gacagaggca aaacccacat gctggcggcc       300
     gtggccagga ccctcgccgg cagggccgag gacgcggccc tgaccctcaa cggcgacgtg       360
     ctgatgctga cccgtgtcgc cggcaccctt cgaaagcaca acacccacgg ctggtgttgt       420
     cgagacgttc cgtcaatcgt tggcggtcac atgacgtcgg cggaggtata tccttaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page