(data stored in ACNUC7421 zone)

EMBL: CP000667.PE580

CP000667.PE580       Location/Qualifiers
FT   CDS_pept        658125..659939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0585"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein;
FT                   translation elongation factor, selenocysteine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53065"
FT                   /db_xref="GOA:A4X2G5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G5"
FT                   /protein_id="ABP53065.1"
FT                   /translation="MFVIATAGHVDHGKSTLVRALTGMEPDRWAEERRRGMTIDLGFAW
FT                   TTLDNEHMTAFVDVPGHQRFVSNMLAGVGPVTAVLFVVAADEGWRRQSAEHLAALQALD
FT                   VRHGVLAVTRCDLADPGPAIEQAHERLRDTGLAGMPAVAVSAASGHGLAALRTALRELT
FT                   RALPAPRTGPARLWVDRSFTVRGSGTVVTGTLGSGTMAVGDELVLEPAGRPVRIRGLQS
FT                   LKTKVERAKAVSRLAVNLRGLGANEVRRGYALVQPGAFTRVTTMDVRLIRQADRLPTHL
FT                   VLHIGSAAVPVRLRKLGPHAARLALTTALPLHVGERGLLRDPGAQHIVAGIVVLDTMPP
FT                   QLHARGDARRRATQLTGMSDRPDAVADIARRGAVRREALVTAGVLAYETEVPADVVAVG
FT                   EWLVAPTLWKTWVSALSAAVDEWAAANPLSPGLAPEAAAGRAGIPDLRLIGALMADAGL
FT                   VLGSGAMRRKDAKIRFPEPVRRALDEIRARLREDPFAAPSAEELARHRLSRQHLAAAVN
FT                   AGLLCRIAPDVYLLPDAPTEAARRLAGIDQPFTVSQARIAWGTSRRVAVPLLEYLDNQG
FT                   ATRRTGNTHRLLTFRTVAGPSLPEPQYH"
     atgttcgtga tcgccacagc cggtcacgtc gaccacggaa agtcgacgct ggtgcgggca        60
     ctgaccggca tggaacccga ccgctgggcc gaggaacgcc gccgcggcat gaccatcgac       120
     ctcgggttcg cctggaccac cctcgacaac gaacacatga ccgcgttcgt cgacgtgccc       180
     ggccaccagc gcttcgtgtc gaacatgctg gccggcgtcg ggccggtcac cgccgtcctg       240
     ttcgtcgtcg ccgccgacga gggctggcga cggcagtcgg cggagcatct ggcggcgctg       300
     caggcccttg acgtgcgcca cggcgtcctc gcggtcaccc gctgcgacct cgccgaccct       360
     ggcccagcca tcgagcaggc acacgaacgg ctacgcgaca ccggtctggc cggaatgccc       420
     gcggtcgcag tatccgcggc ctccggccac ggcctcgccg ctctgcgcac cgcgttgcgc       480
     gaactcacgc gggcgcttcc ggcgccacgg acgggtccag cgagactgtg ggtcgatcga       540
     tccttcaccg tacggggaag cggcaccgtg gtcaccggaa cactcgggtc cggcaccatg       600
     gcggttggcg acgaactcgt actcgaaccc gcaggtcgac ccgtacggat ccgcggcctg       660
     caaagtctca agaccaaggt cgagcgagcc aaggcggtgt cccggctagc ggtcaaccta       720
     cgcggcctcg gcgccaacga ggtccgacgc gggtacgcgc tggtccagcc gggcgccttc       780
     acgagggtca ccaccatgga cgtacggctg ataaggcaag ccgacaggtt acctacccac       840
     ctcgtcctgc atatcggatc ggcggcggtg cccgtacgcc tgagaaaact cggaccacac       900
     gccgcccgcc tcgccctgac caccgcgcta ccgctacacg tgggcgagcg aggcctgctg       960
     cgcgacccag gcgcccagca catcgtcgcc ggcatcgtcg ttctcgacac catgcccccg      1020
     caactccacg cccgaggcga cgccagacgc cgggccacac aactgacggg catgagcgat      1080
     cggcccgacg cggttgctga catcgcccgt cgaggggctg tcaggcgcga agcgctcgtc      1140
     accgcaggag ttctagccta cgaaaccgag gtgccggcag acgtcgtcgc cgtaggcgag      1200
     tggctggtcg ccccaaccct ctggaagacc tgggtgtccg cgttgagcgc agctgtcgac      1260
     gagtgggcgg cggcgaaccc gctctcaccc ggccttgcgc cggaggcggc tgccgggcgg      1320
     gccggcatcc ccgacctccg gctgatcgga gcgctgatgg ccgacgcggg gctcgtgctc      1380
     ggcagcggcg ccatgcgccg caaggatgcc aagatccggt tccccgaacc agtgcgccgc      1440
     gcactcgacg agattcgcgc acgactgcgt gaagacccgt tcgccgcccc cagcgccgag      1500
     gaactcgcac gacaccggtt gtcccggcag cacctggccg ccgcggtcaa cgcgggtctg      1560
     ctgtgccgta tcgcacccga tgtatacctg ctacccgacg cgccgaccga ggcggcgcgc      1620
     cgactcgcgg gcatcgatca gccattcact gtcagccagg cccgcatcgc atggggcacc      1680
     agccgccgcg tcgcggtacc gcttctcgag tacctcgaca atcagggcgc cacccgacgc      1740
     acgggcaaca cacatcggtt gttgactttc cgtactgtag ctgggccttc cctccctgag      1800
     cctcaatacc actga                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page