(data stored in ACNUC7421 zone)

EMBL: CP000667.PE583

CP000667.PE583       Location/Qualifiers
FT   CDS_pept        661962..662345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53068"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G8"
FT                   /protein_id="ABP53068.1"
FT                   /translation="MERVYGIGGYFFRARDPEGLSRWYRDNLGVVAEDLDGYWFQQGGP
FT                   TVFAPFPEHTDYFGSSGQKTMLNFRVVDLDAMLAQLRAGGAEVDHRVETDDNGRFGWAI
FT                   DPEGNRFELWEPADGVADPVTPA"
     atggagcggg tatacggcat cggaggttac ttctttcggg cacgagaccc agaagggctg        60
     agccgatggt atcgggacaa tttgggcgtc gttgcggagg accttgacgg ctactggttc       120
     cagcagggtg gtccgaccgt attcgcgccg tttcccgagc acacggacta cttcggatcg       180
     tcggggcaga agaccatgct gaactttcgg gtggtagacc tcgacgcaat gttggcccag       240
     cttagggccg ggggcgccga ggtggaccac cgcgtcgaga ccgacgacaa cgggcggttc       300
     ggctgggcca tcgatcccga gggcaaccgc ttcgagttgt gggaacctgc cgacggtgtc       360
     gccgatccgg tcaccccggc gtag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page