(data stored in ACNUC7421 zone)

EMBL: CP000667.PE585

CP000667.PE585       Location/Qualifiers
FT   CDS_pept        663369..665141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0590"
FT                   /product="peptidase S9B, dipeptidylpeptidase IV domain
FT                   protein"
FT                   /note="PFAM: peptidase S9B, dipeptidylpeptidase IV domain
FT                   protein; WD40 domain protein beta Propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53070"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H0"
FT                   /protein_id="ABP53070.1"
FT                   /translation="MKRIAGGGGIAGAGVKGFRLRRLAADPNGSGDGAIAPDGTRFVAS
FT                   SKRNGSVNLWFFDLSSGKWQQGTWGTGDDIEAQWSPDGRQLTFTSSRGGHKAIWLYRLS
FT                   DGQVRQLTSADHEEEYPSWSPDGSTVAFVGGSWGRRHFLVVPATGGTPRPVTTNPGRAG
FT                   ACSWAPDGRWLVCHSYDTGAGAVWLLDSQTAEAIQVTDGSSWDYKPTICPTRPAVAFSR
FT                   SNEGRSVIWVQRLGDGTGGPLVVTGADDRWPTWTRDGNHLFFHRLVDEGAGIAVWDRRT
FT                   RVVRDLVPAEHKPRYASFAPDGRRIVYGTEAGGRSRLRILNLDTGTSQPLPAGEAAFPT
FT                   WSPDGRTIACTVRPDPSSRWEIATVDVSSGQVQLWTTGRTDLRGLHAPVSFAPDGRRLV
FT                   FRSETEPFEANLLVLDLNSGRFTNLTEDSWWDEAPSFSPDGRSVIFMSTRGGDWTWGFY
FT                   RIDLDSKEIVTVAGPDYIERNNPQLTVDGRVLSTMVASKVEELYEQLPDGAGRVVTEAG
FT                   PAVRYPVPSADGEQVVFTRTRTTVEYWLAENVWAADSPLAPLARPLVAEAGTPQVIDQP
FT                   PLGPVRSPVDTRRR"
     gtgaagcgga ttgctggggg tggaggcatc gctggggcgg gggtaaaggg attccgtcta        60
     cgacgactcg ccgccgatcc gaacggttcc ggggacggtg ccatagcgcc cgacggaacc       120
     agattcgtcg cttcgtcgaa acgcaacggc tccgtcaatc tttggttttt cgacctgagc       180
     tcggggaaat ggcagcaggg aacgtgggga accggtgacg atatagaggc gcagtggtcg       240
     ccggacggcc ggcagctgac gttcacctca tctcgcggcg gtcacaaggc gatctggttg       300
     taccggctga gcgacggaca agtccggcag ctgacgtcag ccgaccacga ggaggagtac       360
     ccctcgtggt caccggacgg aagcacggtc gccttcgtcg gcggctcgtg gggccgccgg       420
     cactttctgg tggtgcccgc taccggcggc acgcctcgcc cggtgaccac caacccggga       480
     cgcgccggcg cctgttcatg ggcaccggac gggcgatggc ttgtctgcca ctcgtacgac       540
     accggtgcag gcgcagtgtg gctgctcgat agccagaccg cagaggcaat ccaggtcacc       600
     gacggctcgt cgtgggacta caagcccacc atctgcccaa cccggccggc ggtcgccttc       660
     tcgcgaagca acgaggggcg gtccgtcatc tgggttcaac gcctcggcga cggcaccggc       720
     ggcccgcttg tcgtcaccgg tgcggacgat cgctggccca cctggacgcg agacggaaac       780
     cacctcttct tccaccggct ggtagacgag ggggcaggca tcgcggtgtg ggaccgcaga       840
     acgagagtcg tacgggacct cgtgccggca gagcacaagc cccgctacgc gtccttcgct       900
     ccggacggac gccggatcgt ttacggcact gaggccggcg gccgatccag gttgcggatt       960
     ctgaacctgg acaccgggac ttcccagccc ctaccagctg gcgaggccgc cttcccgacc      1020
     tggtccccgg acggtcggac gatcgcatgc acggttcgtc ccgaccccag ctctcgatgg      1080
     gagatcgcga ctgttgatgt gtccagtggg caggtgcagc tctggacaac cggccgtacc      1140
     gacctgcggg gactccacgc gcccgtctcc ttcgcacctg acgggcggcg cctggtgttc      1200
     cgcagcgaga cggaaccgtt cgaagcaaac ctgctcgtcc tggatctcaa cagcggccgg      1260
     ttcaccaacc tcaccgagga cagctggtgg gacgaggcac cgtcgttttc ccccgacggg      1320
     cggagcgtca tcttcatgtc cacccgcggt ggtgactgga catggggctt ctaccgcatc      1380
     gacctggaca gcaaggagat cgtgacggtc gcgggcccgg actacatcga gcgcaacaat      1440
     ccacaactta ccgtcgatgg tcgggtcctg tcgacgatgg tcgcctcgaa ggtcgaagaa      1500
     ctgtacgaac agttgcccga tggtgccggg cgtgtcgtga cggaggcagg accggcagtc      1560
     cgctatcccg tgccgtctgc cgacggtgaa caggtcgtct tcacccgtac ccggacgacc      1620
     gtcgagtact ggctcgcgga aaacgtctgg gccgccgact cgcctctcgc cccactcgca      1680
     cgacccttgg tcgccgaagc cgggacgccg caggtcatcg accagccacc gctcggcccg      1740
     gtacgtagcc ccgtcgatac ccgacgcaga tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page