(data stored in ACNUC7421 zone)

EMBL: CP000667.PE597

CP000667.PE597       Location/Qualifiers
FT   CDS_pept        682590..683900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0602"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53082"
FT                   /db_xref="GOA:A4X2I2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I2"
FT                   /protein_id="ABP53082.1"
FT                   /translation="MLKRLFRRWALVVRAATIAVLLAGWVGRLAVRLLIDALRRAWPKG
FT                   TRGPSGRERLAVTLTDTVERLGPTYVKLGQVLSTRVDLLPPWLCRNLSRLHDRVSPPSD
FT                   VAAVIRTVPPMVTARVVGGAAGLTPAAAGSIACVYQARLDDGREVAIKVRRPGIEQTMR
FT                   LDLALVNVVARAAGRLPAMRQVPLAEIVDQISAAVYEQLDFVREAQSLTRLRDNLRSLP
FT                   DVRVPAVVSELSGHTVLVTEWIGALERSAERSPARQAAVLNGLRAAYQMLFRDGFVHCD
FT                   LHPGNLYLMPDGTAVIVDTGFVRSLTDFTRRRFAEFFYYLGRNDGHRCAEILLSTVLDR
FT                   GGRYDRDGFRDDVVALVARNSSVRASDFDLASFAATLFAIQRSRGLYADPQFVFPILAL
FT                   LVLEGSVHALVPDIDFQAEAVPYVLRGLQETASVRRS"
     atgctgaaga gactttttcg acggtgggcg ctcgttgttc gggccgccac gatcgccgtg        60
     ctgctggctg gctgggtcgg gcggctcgcg gttcgcctgc tgatcgacgc cctgcgcagg       120
     gcgtggccga aaggcacgcg agggcccagc ggccgggagc ggttggcagt cactctcacc       180
     gacacggtcg aacggctcgg tccgacctac gtcaagttgg gtcaggtgct cagcacccgg       240
     gtcgaccttc tgcctccctg gctatgccgg aacctgtccc ggttgcatga ccgggtgtca       300
     ccgccgtcgg acgtcgccgc cgtcatcaga accgtgccac cgatggtgac ggcacgcgtt       360
     gttggcgggg cggctgggct gacaccggcg gcggcgggca gcatcgcctg cgtctaccag       420
     gctcgacttg acgacggccg tgaggtcgcg atcaaagtac ggcggccggg gatcgaacag       480
     accatgagac tcgatctggc gctggtcaac gtcgtcgcac gtgccgccgg ccggctaccc       540
     gcgatgcgcc aggttccact ggcggaaata gtcgaccaga tctcggccgc cgtgtacgag       600
     cagctcgact tcgtccggga ggcacagtcg ctgacccggt tgcgtgataa cctgcgctcc       660
     ctgcctgacg tccgggtgcc ggccgtcgtg tcggagctat ccggccacac ggtcctggtg       720
     acagagtgga tcggggcgct ggaacggagc gctgaacgat cccccgcccg gcaggccgcg       780
     gtgctcaatg ggctgagagc cgcataccag atgctctttc gggacggatt cgtgcactgc       840
     gacctgcacc cagggaatct gtacctgatg ccggacggga cagcggtgat tgtggatacc       900
     ggctttgtgc gcagcctgac cgacttcacg cgccgcaggt ttgccgagtt cttctactac       960
     ctcggccgca acgacgggca ccgctgcgcc gagatcctgc tgtcgacggt gctggaccgc      1020
     gggggccggt acgaccggga cggcttccgg gacgacgtgg tggccctcgt ggcacgcaac      1080
     agctccgtcc gggcctcgga cttcgacctg gcgtccttcg ccgccacgct cttcgcgatc      1140
     cagcgatcgc gcggcttgta cgccgaccca cagttcgtct tcccgatcct ggctctcctg      1200
     gtgcttgaag gcagcgtgca cgcgctcgtg ccggacatcg actttcaggc ggaagcggtg      1260
     ccgtacgtgc tccgcgggct acaggagacg gcttctgtgc gacgcagctg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page