(data stored in ACNUC7421 zone)

EMBL: CP000667.PE60

CP000667.PE60        Location/Qualifiers
FT   CDS_pept        complement(69373..70479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52545"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z5"
FT                   /protein_id="ABP52545.1"
FT                   /translation="MTPEPNERPNLHVAGPNDAAEVLSAEQARPARIRTSWSAADIMAM
FT                   EFAPPKWAVPGVLSEGVNLLCGPPKVGKSWMSLGLGVDVALGGKAFGTIPVERGPVLYL
FT                   ALEDTARRLQSRLSKVLGQRKAPAGLTLATECPPLPQGGDRAIAAWLDRNPSARMVIID
FT                   VFAKLRGNSAPGSSAYDADYAAVGRAKKVADDYGVAFVLVHHVRKAGSDDFLTEVSGTN
FT                   GLAGAADATLVLKRARNQGDGVLHVTGRDVDENEYALNFDTAAGAWQMLDGPAQDHQVG
FT                   ETRAAILRFLRTTPGSTPKAIATEVGLAYDNVKRTCQRMLADGQLAADTGGRYRVPGVP
FT                   PVPGVPQPTLTSENKGDTTETPTLWPQP"
     atgacccccg aaccgaatga gcgaccgaac ctgcacgtag ccgggccgaa cgacgccgcc        60
     gaagtgctgt cggccgagca ggcgcggcca gcgcggatcc gcacctcgtg gtccgccgcc       120
     gacatcatgg cgatggagtt cgccccaccc aagtgggccg tgcccggcgt gctgtccgag       180
     ggcgtcaacc tgctgtgcgg accaccgaag gtcggcaaat cgtggatgtc gctcggcctc       240
     ggtgtcgatg tcgccctcgg cggtaaggcg ttcgggacga ttcccgtcga gcgtggcccg       300
     gtgctgtacc tcgccctgga agacaccgcc cgccgtctgc aatcacggct gagcaaggtg       360
     ctgggccagc gaaaggcacc ggccggtctc accctcgcca ccgagtgccc gcccctaccg       420
     caaggcggag accgggccat cgccgcgtgg ctagaccgca acccatccgc gcgcatggtc       480
     atcatcgacg tgttcgccaa gctacgcggc aactccgcac ccggctcctc cgcctacgac       540
     gccgactacg ccgccgtagg ccgggcgaag aaggtcgccg acgactacgg cgtcgcgttc       600
     gtcctggtcc accacgtacg caaggccgga tccgacgact tcctcaccga ggtctccggc       660
     accaacggcc tcgccggagc cgccgacgcc accctcgtcc tcaaacgggc acgcaaccag       720
     ggcgacggcg tgctccacgt gaccggccgc gatgttgacg aaaacgagta cgccctgaac       780
     ttcgacaccg ccgccggggc gtggcagatg ctcgacggcc cggcccagga tcaccaggtc       840
     ggcgagaccc gcgcagcgat cctgcggttc ctgcgaacca cccccggcag cacacccaag       900
     gccatcgcca ccgaggtcgg tctcgcctac gacaacgtca aacgcacctg tcagcgaatg       960
     ctcgcagacg gacagcttgc cgccgacacc ggtggccggt accgagtccc cggtgtcccc      1020
     cctgtccccg gtgtccccca acccaccctg accagcgaaa acaaggggga caccacggag      1080
     acacccacac tctggccgca accctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page