(data stored in ACNUC7421 zone)

EMBL: CP000667.PE600

CP000667.PE600       Location/Qualifiers
FT   CDS_pept        complement(686319..686702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0605"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53085"
FT                   /db_xref="GOA:A4X2I5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I5"
FT                   /protein_id="ABP53085.1"
FT                   /translation="MSQDKVGTIAGFDLTVQNADGVRDFYADVVGWKPEPLSMGDYDDY
FT                   MMLAQDGNPVAGICHAKSSNADLPPQWITYIAVSDLSASLARVTEKGGEVVRQPNGTGP
FT                   GGFALIKDPAGAIVALMQNPHTS"
     atgagccaag acaaggtagg cacgatcgcg ggcttcgacc tgaccgtcca gaacgccgac        60
     ggtgtccgcg acttctatgc ggacgtggtc ggctggaagc cggagccgct gagcatgggc       120
     gactacgacg actacatgat gctcgcgcag gacggcaacc cggtcgctgg catctgccac       180
     gccaagagca gcaacgccga cctgccgccg cagtggatca cctacatcgc ggtcagcgac       240
     ctctccgcaa gcctagcgcg ggtgaccgaa aagggcggcg aggtcgtacg gcagcccaac       300
     ggcactggtc cgggcggatt cgcactgatc aaggaccccg cgggtgcgat agtcgcacta       360
     atgcagaacc cccacaccag ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page