(data stored in ACNUC7421 zone)

EMBL: CP000667.PE605

CP000667.PE605       Location/Qualifiers
FT   CDS_pept        complement(690095..691012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0610"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53090"
FT                   /db_xref="GOA:A4X2J0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J0"
FT                   /protein_id="ABP53090.1"
FT                   /translation="MRGQSTLRWIPEANCLECTNIGLCAGVGRCLREPTDAARVTAVAR
FT                   AVDYMIEHRAQPIQLVDVARAATMSQFHFHRIFREITCTTPARFLTALRMCEAQHLLLN
FT                   SRRSVTEICSSVGYSSLGTFISQFGRLTGLSPRRFRTVVERIGQVPIQELTDLSGAMAE
FT                   RGPIGAVTSDRQERYCALLGLYRTDRPWERPSAFQVIETDHVVRIPPVSDGEYDTVSVG
FT                   YSPVTTVAEVLGAPVGTLGRVGFGTRTLVARGGRSRHPFHVALRRQRRIDPPVEFSRPL
FT                   LCLVTRANQRDAAPALPTDAADRG"
     gtgcgtggcc agtccacttt gagatggatc cctgaggcca actgtttgga atgtaccaat        60
     attggactct gcgcaggtgt gggccggtgc ctcagggaac ccaccgatgc agcacgggtg       120
     acggcggtgg caagggccgt cgactacatg atcgagcacc gggcgcagcc catccagctc       180
     gtcgatgtcg cgcgggcggc aaccatgagc cagttccatt tccatcggat attccgagag       240
     atcacctgca ccacgccggc gcggtttctc actgcgctca ggatgtgcga ggcacagcac       300
     ctgctgctca actcacggcg gtcggtgacg gaaatatgct cttctgtcgg ctattcgagt       360
     ctcggcacgt tcatcagtca gttcggccgc ctgaccggcc tgtccccgcg ccgcttccgc       420
     acggtcgtcg agcggatcgg ccaagtgccg attcaggaac tgacggacct tagcggcgcg       480
     atggccgagc gcggcccgat cggcgcggtg acctcggacc gacaggagcg gtactgcgcc       540
     ctgctcggac tgtaccggac ggaccgcccg tgggagcggc cgtcagcctt ccaggtcatc       600
     gaaaccgacc acgtggtgcg cataccgccg gtcagcgacg gcgagtacga caccgtctcg       660
     gttgggtaca gcccggtcac gaccgtcgcc gaggtactcg gagcgcccgt cggtaccctc       720
     ggccgggttg gcttcggtac gcggacgcta gtcgcccggg gcggccgatc ccgccatcct       780
     ttccacgtcg ccctgcgccg ccagcgccgc atcgacccac cggtggagtt ttcacgcccc       840
     ctgctctgcc tggtgactcg cgcgaaccag cgtgatgcag ccccggctct gcccacggac       900
     gcagcggatc gcgggtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page