(data stored in ACNUC7421 zone)

EMBL: CP000667.PE607

CP000667.PE607       Location/Qualifiers
FT   CDS_pept        complement(692079..693851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0612"
FT                   /product="Periplasmic component of the Tol biopolymer
FT                   transport system-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53092"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J2"
FT                   /protein_id="ABP53092.1"
FT                   /translation="MNGSAGMLSQPGRVRGPTFQLHRLAEDPAGAGDGAISPDGTRFVA
FT                   SSRRTGSLNLWFYEIATEQWHQGTRGAGDDIEAQWSPDSACLAFTSSRCGHKAVWLYRL
FT                   HEARISRLTFGPYDEEYPNWSPDGSKITFVGGGWAQRQVYLVSATGGPPMPVTDEPGRT
FT                   GACTYLPDGSGLICHSYDTGASAVSILPLDGSMPRQVTDGSTWDYKPTVSSAHPVVAFS
FT                   RSLEGRSVIWVQQLAEPYRGRALVVEAGDDRWPNWTADGQHLFFHRLVDRGVGIWVLDR
FT                   RTDTVTQVVGPDEQPRYGNISPDGTRLIYAAEESGRSVVKVREISGGLTKVLPLGDAAF
FT                   PQWSPNGRTVAYLTRDVSRPRWEIATYDLATATSTVWTCGVTWPKSLHGPLDWSPDSTR
FT                   LVFSTDTEPFEADLCVLDLRDGSVTKLTEDPWWDEAPSWTPDGTGVVFLSTRGGDWTWG
FT                   FYRMDLSTGEIHALARPDYIEKNNPRMLPDGTLIYSLAVSGIEDLFEQLPDGRGRVLSS
FT                   VGPAVRYPVPSRDGSMLAFTRTHRTVEYWLAKNVWGAGSPIADLADGDARRRGTHGPQT
FT                   RTGPVRSPVNTRRR"
     atgaatggtt ccgcgggtat gctttcgcaa ccgggacggg tgcgtggccc gacgttccag        60
     ttgcacaggc tcgccgaaga cccggccggg gcaggcgacg gggcgatctc gccggacggc       120
     acgcgctttg tcgcctcgtc gcggcgcacg ggatcgctca acctctggtt ctacgagatc       180
     gccaccgagc agtggcacca gggcacacgc ggcgcgggcg acgacatcga ggcccagtgg       240
     tcacccgact ccgcctgcct cgcgtttacc tcctcgcgct gcgggcacaa ggcggtctgg       300
     ctgtatcggt tacacgaagc gcggatcagc aggctcacat tcggcccata cgacgaggag       360
     tatccgaact ggtcgccgga cggctctaag atcaccttcg ttgggggtgg ctgggcacag       420
     cggcaggttt acctggtgtc cgccaccggc gggccaccca tgccggtgac cgacgagccc       480
     ggacggacgg gtgcgtgcac ctacctgccc gacggcagcg gcctcatctg ccactcctac       540
     gacactggcg ccagcgcggt gtcgatcctg ccgctagacg gcagtatgcc acgacaggta       600
     accgacggca gcacgtggga ctacaaaccg accgtctcga gtgcgcaccc ggtagtggcg       660
     ttctcccgaa gcctcgaggg acgctcagtg atctgggtgc agcagcttgc cgagccgtac       720
     cgcgggcgcg cgctggtcgt ggaagcaggc gacgaccggt ggccgaactg gaccgcggac       780
     ggccagcacc tcttcttcca tcggctcgtc gaccgcgggg tcggcatctg ggtgctcgac       840
     cgccgcaccg acacggtcac ccaagtcgtt gggccagacg aacagccaag gtacggcaat       900
     atctcccccg acggcacccg gctgatctac gccgcggagg aaagcggccg gtccgtggtg       960
     aaggttcgcg agatcagcgg cgggttgacc aaggtgctcc cgctcggaga cgcggcgttt      1020
     ccgcagtggt ctccgaacgg tcgtactgtc gcctatctca cgcgggatgt gagcagaccg      1080
     cggtgggaga tcgcgaccta tgacctcgcc acggccacga gcaccgtgtg gacctgcggc      1140
     gtcacatggc ccaagagcct gcatgggccg ctggactggt caccggacag cacccggctc      1200
     gtcttcagca cagacactga accgttcgag gcggatctgt gcgtcctgga cctccgggac      1260
     ggcagcgtca ccaagctcac cgaggacccc tggtgggacg aggcaccgtc atggacaccg      1320
     gacggcacgg gtgtcgtttt cctctcgacc cgcggcggtg actggacctg gggcttctac      1380
     cgcatggacc tgagtaccgg tgagatccat gctcttgccc gcccggacta catcgagaag      1440
     aacaaccccc gcatgctgcc cgacggcacg ctcatctact cccttgccgt ttccggcatt      1500
     gaggatctgt tcgagcagct gcccgacgga cgtgggcgcg tgctctcgtc ggtcgggccc      1560
     gctgtccgct acccggtacc cagtcgggat ggctcgatgc tcgcgttcac ccgcacacac      1620
     cgcaccgtcg agtactggct ggcaaaaaac gtgtggggtg cgggctcccc catcgcggac      1680
     ctggccgacg gtgatgcgcg gcgacgcggc acccatggcc cacagacccg caccggaccg      1740
     gtgcgcagtc cggttaacac gcgccgcaga tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page