(data stored in ACNUC7421 zone)

EMBL: CP000667.PE608

CP000667.PE608       Location/Qualifiers
FT   CDS_pept        694139..694798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53093"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J3"
FT                   /protein_id="ABP53093.1"
FT                   /translation="MTEVQDFGRQLGEFSRGLLGATGADEGTEFVSDGRAESEIRGFLA
FT                   ELQEAYARADIDWIVNSLAEDFTTYELVALDGSPVVIREKAAMREYLTTLFPASGENQV
FT                   KSITANQVVATATLGLINEEGDVVISKADTTKEHQPLRASALAVRTEDGWKWRHWHMSE
FT                   AGPRFRVNAAGVPIDDNGQVIPGARVVTQDGVGRVVVDGHETRPGVTLAPGQTRRD"
     gtgactgagg ttcaggattt cggccgacag ctcggtgagt tctcgcgcgg tctgctcggc        60
     gccaccggcg ccgacgaagg tacggagttc gtctccgacg gccgtgccga aagtgagatc       120
     cgcggcttcc tcgcggagct ccaggaggcg tacgcgcggg cggacatcga ctggatcgtc       180
     aactcgctcg ccgaggattt caccacctac gaactcgtgg cgctggacgg gtcgccggtg       240
     gtgatccgcg aaaaggcggc gatgcgcgag tacctcacca ccctgttccc cgccagcggg       300
     gagaaccagg tgaagtcgat caccgcgaac caggtggtgg cgacggcgac gctcggcctc       360
     atcaacgagg agggcgacgt cgtgatctcc aaggcggaca cgaccaagga acaccagccg       420
     ctgcgggcca gcgcgctcgc cgtgcgaacc gaagacggct ggaagtggcg gcactggcac       480
     atgtccgaag ccgggccccg attccgggtg aacgcggccg gcgtgccgat cgacgacaac       540
     ggccaggtga taccgggtgc ccgggtggtg acccaggacg gtgtcggtcg agtggtcgtc       600
     gacgggcatg aaacgcgccc cggcgtcacc ctggcacctg gccagacgcg ccgggactga       660
//

If you have problems or comments...

PBIL Back to PBIL home page