(data stored in ACNUC7421 zone)

EMBL: CP000667.PE610

CP000667.PE610       Location/Qualifiers
FT   CDS_pept        complement(696538..697176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0615"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53095"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J5"
FT                   /protein_id="ABP53095.1"
FT                   /translation="MAHCSSEALGPLVERHKEETADVADDRRESALPSTAYAVLGLLTM
FT                   TGEVTGYELRKWAMNMRYFYWSPAQSQLYLELRRLRDRALVYERTEAQPGRPDKRYYTI
FT                   TDTGRRVFRDWLDHSEVGPPLLKHSVALRLFFGHQTSHSRLREVLTQYAEWARRQQQEL
FT                   SALKGDMLPALRYSSIVADWGVGYFAAEINAVESALASLDAMDSEVGES"
     gtggcacact gctcgtcgga ggctctggga ccgctcgtcg agcgccacaa ggaggagacg        60
     gcagacgtgg ccgacgacag acgagaatcg gcgttgccgt cgacggccta cgccgtcctc       120
     ggtctgctca cgatgaccgg tgaggtcacg ggctacgagc tgcgcaagtg ggccatgaac       180
     atgcggtact tctattggag tcccgcgcag agccagctct atctggaact ccgtagattg       240
     cgcgaccggg cactggtgta cgagcgcacg gaggcacagc caggccggcc cgacaagcgg       300
     tactacacga tcaccgacac cggccggaga gtcttccgcg actggctcga ccacagcgaa       360
     gtaggtccac cactgctcaa gcactcggtc gcgctgcggt tgttcttcgg ccaccagacc       420
     agccacagta gactgcgcga ggtgctcacc cagtacgccg agtgggcacg gcgccagcag       480
     caggagctga gcgcgctgaa gggcgacatg ttgcctgcac tccgctactc gtcaatcgtg       540
     gccgactggg gcgtggggta tttcgcggcg gaaatcaatg ccgtcgagtc ggcgctggca       600
     agcctggatg ccatggactc cgaggttggg gagagctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page