(data stored in ACNUC7421 zone)

EMBL: CP000667.PE611

CP000667.PE611       Location/Qualifiers
FT   CDS_pept        697437..698597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0616"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53096"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J6"
FT                   /protein_id="ABP53096.1"
FT                   /translation="MIQHRWSRAGDGRLLGLAAAAALCAACTTDGVPAPGEESKGPPLL
FT                   FDISATTPVGDNPRAIAAADLNGDGVPDLVTPNLGPGNASVLFGDGRAGVRQVVEIAAG
FT                   PAALRNVTADLNNDGNQDVATINVSDETVTVLHGDGLGGFSEPVAYEAGDGPSGVIAVD
FT                   LNGDDVLDLATANYDGDDVSIMLAEGSGYAAPVHVAVGDGAADIVAADVNGDGQIDLVT
FT                   GNHHSDDVSVLLGDGAGGVAPAISSAAGDGPHGIAAGDFDGDGHVDLATPDYEGDTTSV
FT                   LLGSGDGTFAAPAKLPAGDGPTGLVAVDLDGDGSIDLATANFESDDVSVLRGNGDGTFG
FT                   EPAYVPAGDGAVKIVAVDLDGDGLLDLATANSHDDNVTVLRNTTSQ"
     atgattcagc acaggtggtc cagggccggt gacgggcggc tgctcggact cgcggcggcg        60
     gcggcgctct gcgccgcgtg tacgaccgac ggagtcccgg ctcccggcga ggagtccaag       120
     ggcccaccgc tgctgttcga tatctcggcc accacgcccg tcggggacaa cccgcgcgcg       180
     atcgcggctg cggacctcaa cggcgacggt gtacccgatc tggtcacccc gaacttggga       240
     ccgggcaatg cgtccgtgct cttcggcgac ggcagggcag gcgtgcggca ggtggtcgag       300
     atcgccgccg ggcctgccgc gctgcgcaac gtgaccgcgg acctaaacaa cgatggcaac       360
     caggacgtgg cgacgatcaa cgtgagcgac gagaccgtca cggtgctgca cggcgacggc       420
     cttggtgggt tcagcgagcc ggtcgcgtac gaggcgggcg acggcccatc cggtgtgatc       480
     gccgtcgacc tgaacggcga cgacgtactc gacctcgcga ccgccaacta tgacggtgac       540
     gacgtcagca tcatgctggc cgagggcagc gggtacgccg cacccgtgca cgtcgccgtg       600
     ggcgacggag ccgccgacat cgtggccgca gacgtcaacg gcgacgggca gatcgacctg       660
     gtgaccggta accaccactc cgacgacgtg agcgtgctgc tcggtgacgg cgcgggcggg       720
     gtcgcacctg cgatctcctc agcggccggc gacggcccac acggaatcgc cgcgggggac       780
     ttcgacggcg acggacacgt cgacctcgcg acgccggact acgagggaga cacgacctca       840
     gtgcttctcg gtagcggcga cggcaccttc gccgcgccgg caaagctacc cgctggcgac       900
     ggtccgacgg ggctggtcgc ggtcgacctc gacggtgacg gctcaatcga cctcgcgact       960
     gcgaacttcg agtccgacga cgtgtctgtg cttcgcggca acggtgacgg aacgttcggc      1020
     gagccggcgt acgtgcccgc tggggacggc gcggtgaaga tcgtcgcggt cgacctcgat      1080
     ggtgacgggc tgctcgacct tgccaccgcc aactcccatg acgacaacgt cacggtgctc      1140
     cgcaatacga ccagtcagta g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page