(data stored in ACNUC7421 zone)

EMBL: CP000667.PE618

CP000667.PE618       Location/Qualifiers
FT   CDS_pept        complement(705435..706157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0624"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53103"
FT                   /db_xref="GOA:A4X2K3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K3"
FT                   /protein_id="ABP53103.1"
FT                   /translation="MRSRAARDQDTNGRVLVVDDEQSLAKVVASYLERDGYQVRCVFDG
FT                   PAALDAAREDEPDVVVLDLMLPGLDGVEVCRRLRAFSDCYVIMLTARTEETDKLTGLGV
FT                   GADDYLTKPFSPRELVARVAAMRRRPRQPRIRPEPALRRFGPLEVDVPAREARLDEVPV
FT                   PLTRTEFDLLAVLSGRPNVALSRAQLITAVWGDGWVGDERLVDVHIGHLRRKLGDGPAR
FT                   PRFILTVRGIGYRMRPQS"
     gtgaggagca gggccgcgag ggaccaggac acgaatggac gagtgctggt cgtcgacgac        60
     gaacagagcc tcgccaaggt cgtcgcgagc tacctcgaac gcgacggcta ccaggtgcgc       120
     tgcgtctttg acggcccggc ggcgctggac gccgcgcggg aggacgagcc cgacgtcgtt       180
     gtccttgacc tgatgttgcc cggcctcgac ggtgtggagg tgtgccggcg gttgcgggcg       240
     ttcagcgatt gctacgtcat catgctgacc gcccgcacgg aggagaccga caagctgacc       300
     gggctcggtg tcggggccga cgactacctc accaagccgt tcagccctcg agaactcgtc       360
     gcccgcgtcg cggcgatgcg gcgtcgccca cgccagccgc gcatcaggcc agagccggca       420
     ctgcgccggt tcggtccact ggaggtggac gtgccggccc gcgaggcccg cctcgacgag       480
     gtgcccgtgc cgctcacccg caccgagttc gatctgctgg cggttctgtc cggccggccg       540
     aacgtcgcgc tgagccgcgc ccagctgatc accgcggtgt ggggggacgg gtgggtgggc       600
     gacgagcgcc tggtcgacgt acacatcgga cacctgcgcc gcaagctcgg cgacggcccc       660
     gcccgtcccc ggttcatcct caccgtacgg ggcatcggct accggatgag accgcagtcg       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page