(data stored in ACNUC7421 zone)

EMBL: CP000667.PE619

CP000667.PE619       Location/Qualifiers
FT   CDS_pept        complement(706154..707071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0625"
FT                   /product="glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /note="PFAM: glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53104"
FT                   /db_xref="GOA:A4X2K4"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K4"
FT                   /protein_id="ABP53104.1"
FT                   /translation="MRPRSTPGSGRKTQGRSASAAPTRKIVIAALAGLAVLTAVVVFAL
FT                   RGQGSSDDHTTGDAGNQGFGHVHGIAIDPGSSALHVATHVGLFRIDDPRTAVRVSKDDL
FT                   DLMGFTVVGPQHFLASGHSAHGPANVGLIESTDGGATWQEKSLSGAADFHGLQVAHGSV
FT                   YGYNSTDGAFMVSADQRSWEQRSRTAIGAFAVSPIDGGTVLAVGRDGLQRSTDGGRSWQ
FT                   SVPDTPAVGLLAWDRTGVWAVARDGAVWSSTDGGGQWQRRGAVPGEPDSFAVQDGTLFA
FT                   ALSGDRVVASTDGGATWTDRYAPE"
     atgcgaccgc gcagcacgcc cggatccggg cggaagacgc agggtcgcag tgcgtcggcc        60
     gcaccgacac ggaagatcgt catcgcggcg ctggccgggc tggccgtcct caccgccgtg       120
     gtggtgttcg ccctacgcgg tcagggatct tcggacgacc acaccacagg tgatgccggg       180
     aaccaggggt tcgggcacgt ccacgggatc gcgatcgacc cgggcagcag cgccctgcac       240
     gtcgccacgc acgtcggtct gttccgcatc gacgatccgc ggaccgccgt acgcgtgtcg       300
     aaggacgatc tggacctgat gggcttcacc gtggtcggcc cccagcattt cctggcctcc       360
     ggccactccg cgcacggtcc ggccaacgta ggcctgatcg agtcgaccga cggtggcgcg       420
     acctggcagg agaagtcgct ctccggtgcg gcggacttcc acgggctcca ggtcgcccac       480
     ggctcggtct acggctacaa ctcgaccgac ggcgcgttca tggtcagcgc cgaccagcgg       540
     agctgggagc aacgttcccg gacggcgatc ggcgcgttcg cagtcagccc gatcgacggc       600
     gggaccgtcc tcgccgtcgg acgcgacggc ctgcagcgct ccaccgacgg tggccgcagt       660
     tggcagtcgg tgcccgacac tcccgctgtc ggcctgctgg cctgggaccg caccggcgtg       720
     tgggcggtcg cccgggacgg agcggtctgg tcgtcgaccg acggcggggg gcagtggcag       780
     cggcgcggtg ccgtgccagg tgagcccgac agcttcgccg tgcaggacgg caccctcttc       840
     gccgcgctca gcggtgaccg ggttgtcgcc agcaccgacg gcggtgccac ctggaccgat       900
     cggtacgcac cggagtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page