(data stored in ACNUC7421 zone)

EMBL: CP000667.PE62

CP000667.PE62        Location/Qualifiers
FT   CDS_pept        complement(71191..72366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52547"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z7"
FT                   /protein_id="ABP52547.1"
FT                   /translation="MTGGHWIGASKALGRFVSVDLPYPHICGRTVAAEDTVSGQPLQVA
FT                   RWEKVRYCAACAHDKHLKAHPFTPDSRRPNPMRDATTLREVALAAALRGWHIFPLRPDD
FT                   KRPAFPDHLADACTGRDPRCRNGHTGWEARATTDPDRIRRGWSETPWGVGIACGPSGLV
FT                   VIDLDVRKPDQDAPPGNPHPAATSGIDVFAALCETAGQPIPDDTYAVTTGRGGSHLYFR
FT                   HPADSPALRNTAGERGNGLGWLVDTRAHGGYVVAAGSTVAGRSYTVARDLPVAELPGWL
FT                   AERLAPAPLPPQRPVVVDLPTGRTGAYLDAAITRQLDHLRRAAEGERNHTLYVSAVAFG
FT                   QLAAGGALPADQAEALLEEAALSIGLSRFETLRTIRSGLTVGARRPRTVAA"
     atgaccggcg ggcactggat cggggcgagt aaggccctcg gtcgcttcgt gtcagtcgat        60
     ctgccgtacc cgcacatctg cggccggacc gtcgccgccg aggacaccgt ctccggccag       120
     ccgttgcagg tcgcccggtg ggagaaggtc cgctactgcg ccgcgtgcgc ccacgacaag       180
     cacctcaaag cccacccgtt cacacccgat tcgaggaggc cgaaccccat gcgcgacgcc       240
     acaaccttgc gtgaggtcgc cctcgccgcc gccttacgcg gctggcacat cttccccctg       300
     cggccggacg acaagcggcc cgcgttccct gaccacctgg ccgatgcctg caccggccgg       360
     gacccacgct gccgcaacgg gcacaccggc tgggaggcac gcgccaccac cgaccccgac       420
     cggatccggc gcggctggtc cgaaaccccg tggggagtcg gcatcgcctg cggcccctcc       480
     gggctggtcg tcatcgacct ggacgtacgc aagcccgacc aggacgcgcc gcccggcaac       540
     ccacacccgg ccgcgacaag cggcatcgac gtgttcgccg cgctgtgcga gaccgccgga       600
     cagccgatac ccgacgacac ctacgccgta accacgggcc ggggcggctc gcacctgtac       660
     ttccgacacc cggccgacag ccccgccctg cgcaacacgg ccggggaacg cggtaacggc       720
     ctcggttggc tggtcgacac ccgcgcccac ggcggctacg ttgttgcggc cggaagcacc       780
     gtcgcggggc ggtcctacac cgtcgcccgt gatctgccgg tcgccgagct gcccgggtgg       840
     ctcgccgaac gcctcgcgcc cgcgccgttg ccgccgcaac gaccggtcgt cgttgacctg       900
     ccgaccgggc ggaccggggc ctacctggac gccgcaatca ccaggcaact cgaccacctt       960
     cggcgggccg ctgaaggcga gcgcaaccac acgctctacg tctccgcggt cgccttcggc      1020
     caactcgccg ccggtggcgc actacccgcc gaccaggccg aagcgctgtt ggaagaagcc      1080
     gcgctgtcca tcggcctgtc ccggttcgag acgctgcgca cgatccgctc cggcctcacc      1140
     gtcggtgccc gccgcccccg gacggtggcc gcatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page