(data stored in ACNUC7421 zone)

EMBL: CP000667.PE622

CP000667.PE622       Location/Qualifiers
FT   CDS_pept        complement(709774..709977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0628"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53107"
FT                   /db_xref="GOA:A4X2K7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K7"
FT                   /protein_id="ABP53107.1"
FT                   /translation="MTTGTVKWFNADKGFGFITPDGGGADVFAHFSAIATSGFRSLDEN
FT                   QKVEFDITQGQKGPQAENIRPL"
     atgactacag gtaccgtgaa gtggttcaac gccgacaagg gcttcggctt catcaccccg        60
     gacggcggcg gcgccgacgt cttcgcccac ttctccgcga tcgcgacgag cggcttccgc       120
     agcctcgacg agaaccagaa ggtggagttc gacatcaccc agggccagaa gggcccgcag       180
     gcggagaaca tccgcccgct ttga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page