(data stored in ACNUC7421 zone)

EMBL: CP000667.PE625

CP000667.PE625       Location/Qualifiers
FT   CDS_pept        712307..712675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53110"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L0"
FT                   /protein_id="ABP53110.1"
FT                   /translation="MTTDDWNAHVQQARTETAVRRRCFEVVGFEAGRLHSWRCNSLQRD
FT                   AQDRLGITVNELGLLNTVEQARAAAEMANRDASGSGAVHPGRRTLCLRGCDGDLCRRHL
FT                   LSWSGHGRLRCPRLCRHQ"
     gtgactactg acgattggaa cgcccacgtc cagcaggccc gaacagagac cgccgtacgg        60
     cggcgttgct tcgaagtcgt cgggttcgag gccggcaggc ttcactcgtg gcggtgtaac       120
     agcctgcaac gcgatgccca agatcgcctc gggatcaccg tcaatgagct cgggctcctc       180
     aacaccgtcg agcaggcgcg ggctgcggcc gagatggcca accgcgacgc ttcgggctca       240
     ggtgccgtac acccgggtcg acgcacattg tgcctgcggg ggtgcgacgg tgacctttgc       300
     cgtcgacacc tcctcagttg gtccggccac ggtcgcctcc ggtgcccccg tctctgccga       360
     catcagtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page