(data stored in ACNUC7421 zone)

EMBL: CP000667.PE63

CP000667.PE63        Location/Qualifiers
FT   CDS_pept        complement(72707..74860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52548"
FT                   /db_xref="GOA:A4X0Z8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z8"
FT                   /protein_id="ABP52548.1"
FT                   /translation="MTNTTNAPQTPPANQPGATPNPTPTAKPAAARSTPAGWVTYALST
FT                   WHWRHPHPAWGTINAAGATLGTAGIAAAAGVPAPFALIGGALGAAGAVAGGMADDLSGR
FT                   RLLWRAGSWMLPATWMASTIGLDAVWSGPALGTLTAGTAAAATIATAAGRARRRRTVTR
FT                   HQQAARADAATARERVAVAWEARIARVTDVKVTIRAVQAWPTRSGFTLDADLPTGGATW
FT                   RDIARRTEGLATDARLPNGCEVTVEPGDSRGAVLLHVSTVNRLGEDHYLDDYSPLSINN
FT                   PLAIGVHRNGEQALINLRYACGVLVGQTDSGKTNQLQTINTQLIRAVDAIVWHIDLAGG
FT                   GLARPWVTPWAEGRAPAPAVDWVATTAAEAEIMARAAIEILKGRKPAYQQRMRDANDDK
FT                   IPVGPDLPEIVIVVDEIKTVPAHIVAMLTEISDTGRAAGVRTLSCALRATDDYLPVAIK
FT                   EQARIRVGMRVSDEKELNYLYGWKYNIDSEAAPYQGCGFLLAGEPGEAAPMPFKGYRTD
FT                   PGRIDAAAIAAAGWRPDLDPTSAHLADQVAVRGTHAYTDRWTRTLPTLFTEPTTITNPA
FT                   TIPSQPATTTTPDNSSKADISRMFDPIPGDTLDAALHRLTTITARATDTAAGNPVPELL
FT                   TRALDATEAAGGRIHTADLATHLDMDPGDLGTELGRILRDVGVERHNNTGRLRVGDTSK
FT                   PGYLADTLREAVDAYRASTQKAA"
     atgaccaaca ccaccaacgc cccgcagacc cccccggcca accagccggg ggcaaccccc        60
     aaccccaccc caaccgccaa gcccgccgcc gctcggtcga ccccggccgg gtgggtcacc       120
     tacgccctgt cgacctggca ctggcggcac ccccaccccg catggggaac aatcaacgcc       180
     gccggagcga ccctcggcac cgccggaatc gccgccgccg ccggggttcc cgccccattc       240
     gcgctgatcg gtggggcgct cggcgcggcc ggagccgtcg ccggaggaat ggccgacgac       300
     ctgtccgggc ggcgcctgct ctggcgggcc ggaagctgga tgctgcccgc aacctggatg       360
     gcctccacca tcggactcga cgccgtctgg tccggccccg cgctaggcac cctcaccgcc       420
     ggcaccgccg ccgcagccac catcgccacc gccgccggcc gcgcccgccg ccgccgcacc       480
     gtcacccgcc atcagcaggc agcccgcgcc gacgccgcca ccgcccggga gagggtcgcc       540
     gtggcgtggg aagcgcgcat cgcccgcgtc accgacgtca aagtcacgat ccgagcggta       600
     caggcgtggc ccaccagatc cgggttcacc ctcgacgccg acctccccac cggcggggcg       660
     acctggcggg acatcgcccg ccgcaccgaa ggattggcca ccgacgcccg cctccccaac       720
     gggtgtgagg tcaccgtcga gcccggtgac agccgaggcg cggtgctgct gcacgtgtcc       780
     accgtcaacc ggctcggcga agatcactac ctggacgact acagccccct atccattaac       840
     aaccccctcg cgatcggggt gcaccgcaac ggcgaacaag ccctcatcaa cttgcggtac       900
     gcgtgtgggg tgctggtcgg gcaaaccgac tccggcaaaa ccaaccagct tcagaccatc       960
     aacacccagc tcatccgggc cgtggacgcg atcgtgtggc acatcgacct cgccggaggc      1020
     ggcctcgccc gaccgtgggt caccccctgg gccgaagggc gcgcacccgc ccccgccgtg      1080
     gactgggttg ccaccaccgc cgccgaagcc gaaatcatgg cacgggccgc gattgagatc      1140
     ctcaaagggc gtaaacccgc ctaccagcag cgcatgcgcg acgccaacga cgacaagatc      1200
     cccgtcggcc ccgacctccc cgaaatcgtc atcgtggtgg acgagatcaa aaccgtgccc      1260
     gcgcacatcg tggccatgct caccgaaatc tctgacaccg gccgcgccgc cggtgtccgc      1320
     accctgtcct gcgccctacg cgccaccgac gactaccttc ccgtagccat caaagaacag      1380
     gcgcggatcc gggtcgggat gcgcgtctcc gacgagaagg aactcaacta cctctacggc      1440
     tggaagtaca acatcgactc cgaagccgcc ccctaccaag gctgcggctt cctcctcgcc      1500
     ggcgagccgg gtgaagccgc ccccatgccg ttcaagggct accgcaccga ccccggccgc      1560
     atcgacgccg ccgccatcgc cgccgccggc tggcgacccg acctcgaccc cacctccgcc      1620
     cacctcgccg accaagtcgc cgtacgcggc acccacgcct acaccgaccg ctggacccgc      1680
     accctgccca ccctgttcac cgaacccacc accatcacca accccgccac catccccagc      1740
     cagcccgcca caaccaccac acccgacaac agcagcaaag ctgatatttc acgcatgttc      1800
     gaccccatcc ccggcgacac cctcgacgcc gccctccacc gactcaccac catcaccgca      1860
     cgcgccaccg acaccgccgc cggcaacccc gtacccgagc tactaacccg cgctctcgac      1920
     gccaccgaag ccgccggagg acgcatccac accgccgacc tcgccaccca cctcgacatg      1980
     gaccccggcg acctcggcac cgaactcgga cgcatcctgc gcgacgtcgg cgtcgaacga      2040
     cacaacaaca ccggccgcct acgcgtcggc gacacgtcca aacccggata tctggccgac      2100
     actctccgtg aagcagtaga cgcctaccgg gctagcactc agaaggccgc ctga            2154
//

If you have problems or comments...

PBIL Back to PBIL home page