(data stored in ACNUC7421 zone)

EMBL: CP000667.PE630

CP000667.PE630       Location/Qualifiers
FT   CDS_pept        complement(718170..719606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0636"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53115"
FT                   /db_xref="GOA:A4X2L5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L5"
FT                   /protein_id="ABP53115.1"
FT                   /translation="MKDDSSFRTLANAMAEEIEALPEGTRIATHRELVKRFSASGTTVS
FT                   AALALLTQRGLIVSRPGAGTYRTADRRVTPTGDTSWQESALDAAGPHASPVGSQRDFKA
FT                   HAWMGTLLTPDPDIVDLSGGYLHPGLQPLDALATALSRAAKRAQAWDRPPAAGLPELRD
FT                   WFAADIGGGLGRHDILLCAAGQSALATTMRALAQPGEPVIIESPTYQGTIAAAQAAGLR
FT                   PVPVPLDTDGLRSDHLDQALTRTRARVIIVQPLFQNPTGASLSMARQHEIKAIARRHCA
FT                   FVVEDDFARHMTHDDADPTPPPMISHDPDGTVVHIRSLTKVTSPNLRVGAIAARGQVLA
FT                   RLRSAHLIDTLIVPAPLQLTALEVVTSSGWRRTLKALGVALTHRRTVATEAVTATFGDH
FT                   ALALRPRGGYHLWVSLPAHLDEQQLTAAALAKGVAVTPGTNYYVTDSNPTRIRISYAAA
FT                   PSASDVADAIRRLAPLIIEP"
     atgaaggatg atagcagttt ccgaaccctt gcgaatgcga tggcggagga gatagaggcg        60
     ctacccgaag gcactcgcat cgcgacccat cgagagttgg tgaaacggtt ctcggccagc       120
     gggaccaccg tctccgcggc actggccctc cttacccagc gcggactcat cgtgtctcgc       180
     ccaggcgcag ggacgtaccg caccgccgac cgccgggtga cccccaccgg ggacacgtcc       240
     tggcaagaat cggccctcga cgctgcgggt ccccatgcat cgccggtcgg cagccagcgg       300
     gacttcaagg cacatgcctg gatgggaaca ctgttgacgc cagacccgga catcgtcgat       360
     ctcagcggcg gctacctcca ccccgggcta cagccgttgg atgccctggc aacggcgttg       420
     tcccgtgccg cgaaacgcgc gcaggcatgg gaccgcccgc ccgccgctgg cctgcccgaa       480
     ctgcgcgact ggttcgccgc cgacatcggg ggtggcctcg gacgacacga catactcctg       540
     tgcgcggcgg ggcagagcgc gctcgccacg acgatgcgcg cactcgccca gccaggtgag       600
     ccggtcatca tcgagtcgcc gacctaccag ggcaccatcg ccgccgccca ggccgccggt       660
     ctaagaccgg tgccggttcc cctcgacacc gatggcctgc gctcggatca tctcgaccaa       720
     gccctcaccc gtacgcgagc ccgggtcatc atcgtccagc cgctgttcca gaaccccacc       780
     ggggcgagcc tgtcgatggc ccgccaacac gagatcaaag ccatcgcccg ccgccactgc       840
     gctttcgtcg tcgaagacga tttcgcccga cacatgaccc acgacgacgc cgatcccaca       900
     ccccctccga tgatttccca cgacccggac ggcactgtcg tccacatcag atctttgacg       960
     aaggtgacat caccgaacct gcgcgtcggc gcgatcgcag cccggggcca ggtccttgcc      1020
     cgcctacgat cggcacacct catcgacacc cttatcgttc ccgccccgtt gcagctcacc      1080
     gccctggagg tggtgacctc cagcggatgg cggcgaactc tcaaggcact cggcgtcgcc      1140
     ctgacgcacc gccgcacggt ggccaccgaa gccgtcacgg ccacgttcgg cgaccacgct      1200
     ctcgccctgc gcccccgcgg cggctaccac ctgtgggtct cgctccccgc ccacctcgac      1260
     gaacagcaac tcacggccgc tgccctcgcg aagggcgtcg ccgtcacacc gggcacgaac      1320
     tattacgtca cggacagcaa cccgacgcgg atacgtatca gctacgcggc ggcgccatca      1380
     gcttccgatg tcgcggacgc gatccgccga ctcgcaccac tgatcatcga gccgtga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page