(data stored in ACNUC7421 zone)

EMBL: CP000667.PE631

CP000667.PE631       Location/Qualifiers
FT   CDS_pept        719605..720507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0637"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53116"
FT                   /db_xref="GOA:A4X2L6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L6"
FT                   /protein_id="ABP53116.1"
FT                   /translation="MRVENSAITEIRIPPLSSGTLFASLGVLSFSFSLPATLWVLDGFG
FT                   PWSATGVRGVLAAAVALTALIVARVPLPTRGDWHALTVVAVGCVIGFPLLTTLALQTST
FT                   TAHSAVVVGAMPLATAAISALRTGRRPSLMFWTAASIGAATVMAFTISQNHGQPTIADL
FT                   YLLGGLVVCAAGYVEGGRLSVRMPGWQVIAWGVVLAGPVSLAVCVVALPHEPVRLTVEA
FT                   LVGMAYIAGVSQFGGFVLWYGGMGLIGVTRASQLQLAQPMLTLLWASLILGEPLNVAMP
FT                   LTAAVALGCIVVTQRARMA"
     atgagggtag agaatagcgc tatcaccgaa attcggatac cgccactgtc gagcggtacg        60
     ttgttcgcct ccctcggcgt gctgagtttc tccttcagtc ttccggcgac actctgggtg       120
     cttgacggat tcgggccatg gagcgccacc ggggttcgcg gagtgctggc cgccgctgtc       180
     gcactcaccg cgctgatcgt ggcgcgcgtg ccgttgccga cccgtggtga ctggcatgcc       240
     ctcaccgtgg tggcggtcgg ctgcgtgatc ggcttccccc tgctgaccac ccttgcgctg       300
     cagacatcga ccaccgcgca ctcagccgtt gtcgtcgggg cgatgccgct ggccaccgcg       360
     gcgatctctg ctctgcgtac cggccgccgt ccgtctctga tgttctggac ggcagcatcc       420
     atcggcgcgg ccaccgtcat ggcgttcacc atctcgcaaa accatggcca accgacgatt       480
     gccgatctct acctactcgg tgggctggtg gtctgcgctg ctggctatgt cgaaggcggc       540
     aggctctcgg tccggatgcc cggctggcag gtcatcgcat ggggcgtcgt gctcgccggg       600
     ccggtcagcc tcgccgtctg cgtggtcgca ctcccgcacg agccggttcg cctgactgtc       660
     gaggcgctcg tcgggatggc atacatcgcg ggcgtttcgc agttcggcgg cttcgtgctc       720
     tggtacggcg gtatgggcct catcggggtc acccgggcga gtcagctgca actcgcccag       780
     cccatgctga cactgctatg ggcatccctg atcttgggag agccgctcaa cgtcgccatg       840
     ccgctgaccg cggccgtcgc tctcggttgt atcgtcgtca cgcagcgggc gaggatggcg       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page