(data stored in ACNUC7421 zone)

EMBL: CP000667.PE634

CP000667.PE634       Location/Qualifiers
FT   CDS_pept        723025..723909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53119"
FT                   /db_xref="InterPro:IPR022074"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L9"
FT                   /protein_id="ABP53119.1"
FT                   /translation="MAGMDGSGFPGVSLHPACSQALRHVATRSAGPPVDASLRITLNFH
FT                   PDWMTTGSPVLGKMVEDGVYLSQFVTGTSNGGLSAYPGGDRWRWEQRMFGGAYDAVPAH
FT                   CRPVYGALNFRHKPTGAAPRFGSAHLRLTASTLGRATFCYPDSHLEPTMFGVAERMSLV
FT                   DLARADCRDDLDDYVEAQVHGAVRLDRDVEALVLDSCYRGTDVENLARRLPCPLEWHPG
FT                   FRLSIAELRRHPDYRGPRYVELGVALAIGGYLNPRLIGDAVRTGRYRRQDLKRVWHHLA
FT                   RFGGPATPSRIPG"
     atggcaggta tggatgggag tggatttccg ggagtcagtc tgcatcccgc ctgttcgcag        60
     gcgctgcgcc atgtagccac tcggtccgct ggacccccgg tcgacgcatc gttgcgaatc       120
     accctgaact tccatcctga ctggatgacg actggtagcc ccgttctcgg caagatggtg       180
     gaggacgggg tctacctgtc ccagtttgtc accggcacca gcaacggtgg gctctccgcc       240
     tatcccggcg gagaccggtg gcgttgggaa cagcgcatgt tcggaggcgc ctacgacgcg       300
     gttcccgccc actgccgacc ggtgtacggc gccctgaact tccggcacaa gcccaccggt       360
     gccgcacccc gattcggatc agctcaccta cggctgacgg cgtccacgct gggtcgagcg       420
     accttctgct acccggacag ccacctcgag ccaaccatgt ttggagtggc cgaacgcatg       480
     tcgctggttg atctggcccg cgctgattgc cgggatgact tggacgacta cgttgaggcg       540
     caggtgcacg gtgcggttcg gctcgaccgc gatgtcgagg cactcgtgct ggactcctgc       600
     taccgcggca ccgacgtgga gaacctcgcc cgtcgcctgc cctgcccgct ggagtggcat       660
     ccggggttcc ggctctccat agccgagctc cgtcggcacc ccgactaccg tggcccgcgc       720
     tacgtggagc tcggtgtcgc tctcgccatt gggggttacc tcaacccgcg cctcatcggg       780
     gatgctgtcc gcactggccg ctaccgccgc caggacctca agcgcgtctg gcaccacctc       840
     gcccgtttcg gtggacccgc tacgccgtcc cgcatccctg gctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page