(data stored in ACNUC7421 zone)

EMBL: CP000667.PE644

CP000667.PE644       Location/Qualifiers
FT   CDS_pept        complement(733327..733659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53129"
FT                   /db_xref="GOA:A4X2M9"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M9"
FT                   /protein_id="ABP53129.1"
FT                   /translation="MTRTRTWNLPVPVGVNLLLGIPAIVPLFLAWYIIVNGPLAALGWT
FT                   QRNPNEDDGMLLWLVIAAPVFCLFGLIWGLANLRMRRRTATSASQYWIACVIASLAPYI
FT                   VGFFLF"
     ttgacacgta cgcgaacgtg gaatctgcct gtgcccgtcg gcgtgaacct gctgctcggg        60
     atcccggcaa tagtgccctt gttcctggcc tggtacatca tcgtgaacgg accgctggca       120
     gccctgggat ggacgcagcg gaacccaaac gaggacgacg ggatgcttct ctggttggtc       180
     atcgccgcgc cagtgttctg cctgttcggc ctgatctggg ggctggcgaa tctgcggatg       240
     cgccgtagaa cggccacctc tgcatcccag tactggatcg cgtgcgtgat cgcgtccctg       300
     gcgccgtata tcgtcggctt ctttctgttc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page