(data stored in ACNUC7421 zone)

EMBL: CP000667.PE67

CP000667.PE67        Location/Qualifiers
FT   CDS_pept        complement(77206..78267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52552"
FT                   /db_xref="GOA:A4X102"
FT                   /db_xref="UniProtKB/TrEMBL:A4X102"
FT                   /protein_id="ABP52552.1"
FT                   /translation="MTAPTLDSRAYTHRAGLLVPTSIIGGEGPTDASDDRFAESMVNPE
FT                   PVQPSSPAPAPTGKDAAARVAPPLVKVGRAERRRRQRVEGERAARHARLAGDTARVQRW
FT                   QARAAEARQLRRLLTDPDVRAVRLMRQRARWTAMAWMALLFSMGFTMVNVQRFAAIGSE
FT                   QWSPMWVVAWLVDPAFSVLLVGVLIARGSLAAVGHQMHDTALVRIERVLLAAIAGMNIM
FT                   PTISHRYDSLTEHLFQVALHMAIPALAFGAAVALPLIQAHFARAIEALSDARPDAINLP
FT                   KLAADPTAAVELSANDRTLLTDVRNAITTGVLEPDPTGHAIHRRVMSGRGDKARAYRVA
FT                   GFVNGWRPELATA"
     atgaccgccc ccacgctcga tagccgcgcc tatacccatc gggccggatt gttggtgccc        60
     acctcgatca tcgggggcga ggggccaacc gatgcgtccg acgaccggtt cgccgagtcc       120
     atggtgaacc cggagccggt acagccttcc tcgcccgcgc ctgctccgac cggtaaggat       180
     gccgccgcgc gggtggcgcc gcccctggtg aaggtgggtc gggccgagcg tcgccgtcgg       240
     cagcgtgtcg agggtgagcg tgcggcgcgg cacgcgcggt tggcgggtga cacggctcgg       300
     gtgcagcggt ggcaagcgcg ggcggctgag gcccgccagc tacggcggct gctgaccgat       360
     ccggatgtgc gggcggttcg gttgatgcgt cagcgtgccc ggtggaccgc gatggcctgg       420
     atggcgttgc tgttcagcat gggcttcacg atggtcaacg ttcagcggtt cgcggcgatc       480
     ggctccgagc agtggtcccc gatgtgggtg gtggcgtggc ttgtcgaccc ggcgtttagc       540
     gtgctgctag ttggtgtgct gatcgcccgg ggttccctgg ccgctgtcgg ccaccagatg       600
     cacgacacgg cgctagtgcg tatcgagcgg gtgctgctgg ccgcgatcgc gggcatgaac       660
     atcatgccga cgatcagcca ccgctacgac agcctgaccg agcacctgtt ccaggtggcg       720
     ctgcacatgg cgattccggc gttggcgttc ggcgcggccg tggccctacc cctgattcag       780
     gcccacttcg cccgcgcgat cgaggccctg tcggatgccc gtccggatgc catcaacctg       840
     cccaaactcg ccgccgaccc gaccgcagcg gtggagcttt ccgccaacga ccggacgctt       900
     ctgaccgacg tccggaacgc catcacgacc ggggtcttgg agccggaccc gaccggtcac       960
     gcgatccacc ggcgagtgat gtccggccgg ggcgacaagg cccgcgccta ccgcgtcgcc      1020
     ggcttcgtca acggctggcg acccgaactc gccaccgcct ag                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page