(data stored in ACNUC7421 zone)

EMBL: CP000667.PE7

CP000667.PE7         Location/Qualifiers
FT   CDS_pept        complement(6924..7505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52492"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U2"
FT                   /protein_id="ABP52492.1"
FT                   /translation="MGLDNVVVNWPRTGRFYDPVAPAEFVDFGEIVDMPQISAPTAALA
FT                   ELIAKTGTVRATAYTELVDLILGLENVLYATDHSAEDEDPVIDPDGCGWIADGVERFVA
FT                   RHRAVGEAVTFDTVSEVLRALLGDGRLAEQQLRWLDSRLDRLRDESGDPPQWTFTCAEL
FT                   SVLAAFYRRCAERGFAVYAESVAPRRAVQP"
     atggggctgg ataacgtcgt ggtgaactgg ccgcggaccg gccgcttcta cgacccggtc        60
     gcgccggccg agttcgtgga cttcggcgag atcgtcgaca tgccgcagat ctccgcgccg       120
     acggccgcgc tcgccgaact gatcgccaag accggcacgg tccgggcgac cgcgtacacc       180
     gaactggtcg atctgatcct cggcttggag aatgtgctct acgccacaga tcactcggcg       240
     gaagacgagg acccggtgat cgacccggac ggctgcgggt ggatcgccga cggagtcgag       300
     cggttcgtgg cccggcatcg agcagtcggg gaggcggtca ccttcgacac cgtcagcgag       360
     gtgctccgcg cgttactcgg cgacggacgc ctggccgaac agcagctgcg ctggctggac       420
     agccggctgg accggctccg cgacgaaagc ggggatccgc cgcagtggac cttcacctgc       480
     gcggagctga gcgtactcgc cgcgttctac cgccgctgcg ccgagcgggg cttcgcggtc       540
     tacgccgagt cggtggcacc ccgccgggcc gttcagccgt ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page