(data stored in ACNUC7421 zone)

EMBL: CP000667.PE77

CP000667.PE77        Location/Qualifiers
FT   CDS_pept        complement(84655..85152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0077"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52562"
FT                   /db_xref="GOA:A4X112"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4X112"
FT                   /protein_id="ABP52562.1"
FT                   /translation="MTFEEYAFARTAALVRLARLLTGDEHRAEDLVQDVLAKAYARWGR
FT                   ISRIDQPEAYVRRMLVNANRSWWRRGSRREICTPAVSDRVGGVDEAAGVVERDTLWRLV
FT                   RALPTRQRTVIVLRYYEDLDDTAIAEIVGCSTGTVRTHARRALQALRKHQEAPTPARTG
FT                   GI"
     gtgacgttcg aggagtacgc gttcgcgcgc accgcagcgc tggtgcggct cgcccggctg        60
     ctgacaggtg acgagcatcg tgccgaggac ctggtccagg acgtgctggc gaaggcgtac       120
     gcacgctggg gacgcatctc tcggatcgat caacccgagg cttatgtccg ccggatgctg       180
     gtcaacgcga atcgctcgtg gtggcgccga ggcagccggc gagagatctg cacccctgcg       240
     gtgagcgacc gcgtgggcgg ggtggacgag gcggccgggg tcgtcgaacg cgacaccttg       300
     tggcgactcg tccgtgcgct gccgacacgg cagcgcaccg tgatcgttct gcgctactac       360
     gaagatcttg acgatacggc gatcgccgag atcgtgggtt gttcgaccgg cacagttcgc       420
     acgcatgcga ggcgcgccct gcaggcgcta cggaaacacc aggaggcacc tacgcccgca       480
     cggacgggag ggatttga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page