(data stored in ACNUC7421 zone)

EMBL: CP000667.PE9

CP000667.PE9         Location/Qualifiers
FT   CDS_pept        10079..12598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0009"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52494"
FT                   /db_xref="GOA:A4X0U4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U4"
FT                   /protein_id="ABP52494.1"
FT                   /translation="MTDTPESTPNEPDVPETAGAVVAHDRIEPVGLEVEMQRSYLDYAM
FT                   SVIVGRALPDVRDGLKPVHRKILYAMFDSGYRPDRGYVKCSRVVGDVMGQFHPHGDSAI
FT                   YDALVRMAQPWALRYPLVDGNGNFGSPGNDPAAAMRYTECKLEPLAMEMLRDIDEDTVD
FT                   LQDNYDGRAKEPTILPSRIPNLLVNGSEGIAVGMATKIPPHNLREIGAAVQWCLEHPEA
FT                   DEASTLEALLGIVKGPDFPTHGLIVGRAGIQDAYRTGRGSIRMRAVVEVEEDKRGRPAL
FT                   VVSELPYQVNPDNLAERIAELIKEGKLAGIADIRDESSGRTGMRLVLVLKRDAVAKVVL
FT                   NNLYKHTQLQETFGANMLALVDGVPRTLNLAQFIRYYVAHQIEVIRRRTAFRLRKAEER
FT                   AHILRGLAKALDALDEVIALIRRSPTVDDARQGLIRLLEIDEIQATAILDMQLRRLAAL
FT                   ERQRILDDLAKLELEIADFKDILAKPERQRRIVSEELGEIVAKWGDDRRTQIIPFDGEV
FT                   SMEDLIAREDIVVTITRTGYAKRTKVDAYRSQRRGGKGVSGASLRQDDIVSHFFVCSTH
FT                   DWILFFTNKGRVYRAKAYELPEASRVAKGQHVANLLAFQPDEQIAQIIEISDYQVAPYL
FT                   VLATKNGVVKKTRLEEFDSNRSGGIIAINLREDDELVGAALVAPEQDLLLVSKNALAIR
FT                   FNATDEALRPMGRATSGVIGMRFSEDDELLAMEVVRHGLDVLVATNGGYAKRTPIEEYP
FT                   VQGRGGKGVLTAKITERRGGLVGAVVIDPDDELFAITSNGGVIRTPVKPVRRTRDRNTM
FT                   GVKLMDLPDGVTIVAIARNADEPDEQD"
     gtgaccgata cccccgagtc cacaccgaac gagcccgacg tccccgagac cgccggcgcc        60
     gtcgtggcgc acgaccggat cgagccggtc gggctcgagg tggagatgca gcgttcctac       120
     ctcgactacg ccatgagcgt gatcgtcggg cgggcgctgc cggacgtccg ggacgggctg       180
     aagccggtcc accgcaagat cctctacgcg atgttcgact cggggtaccg gcccgaccgg       240
     gggtacgtga agtgctctcg ggtggtcggc gatgtgatgg gccagttcca tccgcacggc       300
     gactcggcga tctacgacgc cctggtccgg atggcccagc cctgggcgct gcgctacccg       360
     ctggtggatg gcaacggcaa cttcgggtcg ccgggcaacg atccggccgc ggcgatgcgg       420
     tacaccgagt gcaagctcga accgctggcg atggagatgc tgcgggacat cgacgaggac       480
     accgtcgacc tgcaggacaa ctacgacggg cgggccaagg agcccacgat cctgccgtcc       540
     cggatcccca acctactggt caacggctcc gaaggcatcg cggtcggaat ggccaccaag       600
     atcccaccgc acaacctgcg ggagatcggc gcggcggtgc agtggtgcct ggagcacccg       660
     gaggccgacg aggcgagcac tctggaagcc cttctgggga tcgtcaaggg tccggacttc       720
     ccgacccacg gcctgatcgt cggccgggcg gggatccagg acgcgtaccg caccggtcgc       780
     ggctcgatcc ggatgcgcgc cgtggtcgag gtcgaggagg acaagcgggg ccggccagcg       840
     ctggtggtca gcgagctgcc gtaccaggtg aaccccgaca acctggccga gcggatcgct       900
     gagctgatca aggaggggaa gctcgccgga atcgccgaca tccgggacga gtcctccggc       960
     cggaccggca tgcggctggt gctggtgctc aagcgcgacg cggtcgccaa ggtggtgctg      1020
     aacaacctct acaagcacac ccagcttcag gagaccttcg gcgcgaacat gctggcgctg      1080
     gtggacggcg tgccgcgcac gctcaacctg gcccagttca tccgctacta cgtcgctcac      1140
     cagatcgagg tgatccgccg gcggacggcg ttccggctgc gtaaggccga ggaacgggcg      1200
     cacatcctgc gcggtctggc caaggcgctg gacgccctcg acgaggtgat cgcgctgatc      1260
     cggcgctcgc cgacggtgga tgacgcgcgg cagggtctga tccggttgct ggagatcgac      1320
     gagatccagg ccaccgcgat cctggacatg cagctgcggc ggctggccgc gctggaacgg      1380
     cagcggattc tcgacgacct ggcgaagctc gagctggaga tcgccgactt caaggacatt      1440
     ctggcgaagc cggagcggca gcggcggatc gtctcggagg agctgggtga gatcgtcgcg      1500
     aagtggggcg acgaccggcg tacccagatc attccgttcg acggcgaggt ctcgatggag      1560
     gacctgatcg cccgcgagga catcgtcgtc accattaccc gaaccgggta cgcgaagcgc      1620
     accaaggtgg acgcgtaccg ctcgcagcgg cggggcggta agggggtcag cggcgcctcg      1680
     ctgcggcagg acgacatcgt cagccatttc ttcgtgtgct cgacgcacga ctggattttg      1740
     ttcttcacca acaagggtcg ggtgtaccgg gccaaggcgt atgagctccc ggaagccagt      1800
     agggtggcca agggccaaca cgtggccaat ctgctcgcct tccaaccaga cgagcagatc      1860
     gcacagatca tcgagatttc cgactaccag gtcgccccct acctggttct ggccacaaag      1920
     aacggagtgg taaagaagac gaggctcgag gagttcgact ccaaccggtc cggcggcatc      1980
     atcgcgatca acctgcgcga ggacgacgaa ctggtcggtg ccgccctggt ggcgccggag      2040
     caggatctcc tgctggtgtc gaagaacgcc ttggcgatcc ggttcaacgc caccgacgag      2100
     gcgctgcggc cgatggggcg ggctacctcg ggtgtgatcg ggatgcggtt cagcgaggac      2160
     gacgagttgc tcgcgatgga ggtcgtccgg cacggcctgg acgtcctggt ggctaccaac      2220
     ggcggctacg cgaaacgtac tccgattgag gaatacccgg tccagggccg gggaggtaag      2280
     ggcgtgctga ctgcgaagat caccgagcgg cgcggtggtc tggtcggtgc tgtggtgatc      2340
     gacccggacg acgagctctt cgctatcacc agtaacggtg gtgtcattcg gactccggtg      2400
     aagcctgtac gccgtacgcg cgaccggaac acaatggggg tcaagctgat ggaccttccg      2460
     gatggcgtaa ccatcgtggc gattgctcgc aatgccgacg agcctgacga acaggactag      2520
//

If you have problems or comments...

PBIL Back to PBIL home page