(data stored in ACNUC7421 zone)

EMBL: CP000667.PE90

CP000667.PE90        Location/Qualifiers
FT   CDS_pept        99117..99386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52575"
FT                   /db_xref="GOA:A4X125"
FT                   /db_xref="UniProtKB/TrEMBL:A4X125"
FT                   /protein_id="ABP52575.1"
FT                   /translation="MGIGSGIFLIALGAILTFAIRANVWWVDLRAVGWVFILAGLAVLL
FT                   TTVWFWQDRRKRARTLIVEENRLSHPTAMMPPPPDPPPPTAPPS"
     atgggcattg gtagcggtat tttcctgatc gccctcgggg cgatcctcac cttcgcgatc        60
     cgggccaacg tctggtgggt tgacctgcgt gcggtcggct gggtcttcat cctggccggg       120
     ttggccgtcc tcctcaccac ggtgtggttc tggcaggacc ggcgcaagcg ggcacggacc       180
     ctgatcgtgg aggagaaccg gctgtcgcat ccgaccgcga tgatgccgcc gccgcccgat       240
     ccgccgccgc ccacagcgcc accgtcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page