(data stored in ACNUC7421 zone)

EMBL: CP000667.PE93

CP000667.PE93        Location/Qualifiers
FT   CDS_pept        101108..101827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0093"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52578"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X128"
FT                   /protein_id="ABP52578.1"
FT                   /translation="MHLHVKGLPMPTLRAQFVLFDGFDLLDVIAPLEVLSAGSAALGGV
FT                   LECVLVSESGRDSIPSGAAGLSLPASAALEPEAPGYVIVPGASGPVDGDPDAGELTVPA
FT                   LLGRFAGSPTMALVARALAAPQVTVVAVCGGGLALAMAGLLEGRTATTHHLGIDSLESI
FT                   GVNAVRARVVDDGDLVTGGGVLSGVDVALYLLERDFGCAAARAVEDLFEFERRGTTWKA
FT                   PAGSLPRAPVVGQRVQA"
     atgcacctac acgtgaaggg actaccgatg cccacgcttc gcgcccagtt tgtgctcttc        60
     gacggctttg atctgctcga tgtcatcgcc ccactcgagg tgctttccgc aggcagcgcc       120
     gccctcggtg gcgtactcga atgtgtgctg gtgagcgagt cgggacggga cagcatcccg       180
     tcgggagccg caggcctctc cctccccgcc agcgccgcgc tggagccgga ggcacccggc       240
     tacgtcatcg ttccgggtgc ctccgggccc gtcgacggcg acccggacgc aggcgagttg       300
     accgttcccg cgttgctcgg gcggttcgcc ggaagtccga cgatggcact cgtcgcccgg       360
     gctctcgccg cgccgcaggt caccgtcgtc gccgtctgcg gtggcgggct cgcgctcgcc       420
     atggcgggcc tgctggaggg gagaacggcc accacccatc acctcggcat cgatagcctg       480
     gagtccatcg gcgtgaacgc ggtccgggcg cgggtcgtcg acgacggtga tctcgtcact       540
     ggcggcggtg tcctgtccgg cgtcgacgta gccctctacc tgctcgaacg tgacttcggc       600
     tgcgccgctg cccgcgccgt cgaggacctc ttcgagttcg agcgtcgcgg caccacctgg       660
     aaagcgcctg ccggaagcct gccccgcgca cctgtcgtcg ggcagcgagt gcaggcatga       720
//

If you have problems or comments...

PBIL Back to PBIL home page