(data stored in ACNUC7421 zone)

EMBL: CP000667.PE96

CP000667.PE96        Location/Qualifiers
FT   CDS_pept        complement(102658..103335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0096"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52581"
FT                   /db_xref="GOA:A4X131"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A4X131"
FT                   /protein_id="ABP52581.1"
FT                   /translation="MTTSAPSRLKPTDLGKPRMRGWLHTYAFFVAVAGGIVLCSIAAAR
FT                   TGWSPLVSTLIYSLTVCGLFGTSGLYHRRVWSERGFQVMRRMDHSMIFVFIAGTYTPFC
FT                   VLLLEPRPATIMLSLVWGGALGGVALKLIWPHAPRWVSAPLYLALGWVAVAMLPDILHA
FT                   GGVTALVLLIVGGAIYSIGAVSYALRRPNPWPTVFGHHEFFHACTLVAAICHHIAIYFA
FT                   LFA"
     gtgaccacct ccgcgccaag ccgcctcaag ccgaccgacc tcggcaagcc gcggatgcgc        60
     ggctggctgc acacgtacgc gttcttcgtc gccgtcgccg gcgggatcgt cctctgctcc       120
     atcgccgctg cccggaccgg ctggtcgccg ctggtcagca ccctgatcta cagcctgacc       180
     gtctgcggac tcttcggcac cagcgggctc taccaccgac gggtgtggtc agagcggggc       240
     ttccaggtca tgcggcggat ggaccactcg atgatcttcg tcttcatcgc tggtacgtac       300
     acgccgttct gcgtcctgct gctggagccc cgaccggcga cgatcatgct ctcgctggtg       360
     tggggcggcg cgctcggggg cgtggcgctc aagctcatct ggccgcacgc cccgcgctgg       420
     gtctccgcgc cgctctacct ggcgctcggt tgggttgcgg tggcgatgct gcccgatatt       480
     ctccacgcgg gcggggtgac cgccctggtc ctgctgatcg tcggcggcgc gatctacagc       540
     atcggcgcgg tcagctacgc cctccgtcgg cccaacccgt ggcccaccgt cttcggccac       600
     cacgagttct tccacgcctg caccctggtg gccgcgatct gccaccacat cgcgatctac       660
     ttcgccctct tcgcctag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page